(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE88

PENCW_10.PE88        Location/Qualifiers
FT   CDS             join(215509..215645,215698..215854,215915..216125,
FT                   216182..216579,216627..216710,216765..216902)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000031471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824601"
FT                   /orf_name="Pc13g00880"
FT                   /product="Pc13g00880 protein"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91157.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001831041"
FT                   /db_xref="UniProtKB/TrEMBL:B6H195"
FT                   /transl_table=1
FT                   /translation="MLFPVPWGLAVSTFFMLQFTFSAALNGTIRTYYVGAVEEDWDYMP
FT                   TGIDLINGVEIDQSPQAAAVAAHNGQRIGHVYTKAMFREFTDDTFAVQARRPQWLGMLG
FT                   PVIRAEVGDTVEVIFKNMASNNHSMHPHGLRYSKPNEGVAMAGQEFSGNSVPPGETWTY
FT                   TWEVPERAGPGPLDPPSLAWTYHSDVSGAQDIYSGLVGAIIIYRPGELAKHTLDVPAPR
FT                   GSDLTEEVLTLFMIVDENLSFYIDGNTLNRTNIPRGELQVNRLDPGFQESNLKHAINGR
FT                   LFGNLEGLTLTVGRKARWHVQSLGNVQNAHTPHWHGNTLTWAGQRLDVLSVLPAQTRSL
FT                   TMTVDNPGVWVHHCQVLNHRSKGMIVKYHAVDQD"
     MLFPVPWGLA VSTFFMLQFT FSAALNGTIR TYYVGAVEED WDYMPTGIDL INGVEIDQSP        60
     QAAAVAAHNG QRIGHVYTKA MFREFTDDTF AVQARRPQWL GMLGPVIRAE VGDTVEVIFK       120
     NMASNNHSMH PHGLRYSKPN EGVAMAGQEF SGNSVPPGET WTYTWEVPER AGPGPLDPPS       180
     LAWTYHSDVS GAQDIYSGLV GAIIIYRPGE LAKHTLDVPA PRGSDLTEEV LTLFMIVDEN       240
     LSFYIDGNTL NRTNIPRGEL QVNRLDPGFQ ESNLKHAING RLFGNLEGLT LTVGRKARWH       300
     VQSLGNVQNA HTPHWHGNTL TWAGQRLDVL SVLPAQTRSL TMTVDNPGVW VHHCQVLNHR       360
     SKGMIVKYHA VDQD                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page