(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE89

PENCW_10.PE89        Location/Qualifiers
FT   CDS             join(complement(218269..218344),complement(218077..218217),
FT                   complement(217400..218019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128945"
FT                   /orf_name="Pc13g00890"
FT                   /product="Pc13g00890 protein"
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91158.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI0001831042"
FT                   /db_xref="UniProtKB/TrEMBL:B6H194"
FT                   /transl_table=1
FT                   /translation="MLIDREKWACAACIRGHRAASCSHSERPLTIINKKGRPVSQCLHC
FT                   RSLRESRSAHVKCGCGNTNRARNDSGTQDSYPQCNCARGERCVCALKKDPFPDLVPKPS
FT                   WPHSPVHEEGRNTLAQPESVVAALHEDYSRYPGRFNSIQISPSESAPEFQISDQHTRLQ
FT                   SNSAEDSLPANSVISPTDLSSFTNLSSTMEPDYSAPTALDNFSVQQTMAENLDLDMSSF
FT                   PTVDFPIITTSAGSINDINSEYLYREDMFTSTYTQSTPGLTGADSYTADWEGLYPD"
     MLIDREKWAC AACIRGHRAA SCSHSERPLT IINKKGRPVS QCLHCRSLRE SRSAHVKCGC        60
     GNTNRARNDS GTQDSYPQCN CARGERCVCA LKKDPFPDLV PKPSWPHSPV HEEGRNTLAQ       120
     PESVVAALHE DYSRYPGRFN SIQISPSESA PEFQISDQHT RLQSNSAEDS LPANSVISPT       180
     DLSSFTNLSS TMEPDYSAPT ALDNFSVQQT MAENLDLDMS SFPTVDFPII TTSAGSINDI       240
     NSEYLYREDM FTSTYTQSTP GLTGADSYTA DWEGLYPD                               278
//

If you have problems or comments...

PBIL Back to PBIL home page