(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE9

PENCW_10.PE9         Location/Qualifiers
FT   CDS             complement(23386..23775)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128673"
FT                   /orf_name="Pc13g00090"
FT                   /product="Putative uncharacterized protein Pc13g00090 "
FT                   /protein_id="CAP91078.1"
FT                   /db_xref="UniParc:UPI0001830CFB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F8"
FT                   /transl_table=1
FT                   /translation="MTPTTMMNTNFTQPVECYNSRDAVPATMPSNIQYYNQVPLYQTKS
FT                   PNRDMKAVLQSCCSNVVWIYEDPDPCTAVCDSHTAAEAKKTMYCLNAQMVVYGTKTEKG
FT                   SAVARRPMGWLSLMVGGLRLSGMFI"
     MTPTTMMNTN FTQPVECYNS RDAVPATMPS NIQYYNQVPL YQTKSPNRDM KAVLQSCCSN        60
     VVWIYEDPDP CTAVCDSHTA AEAKKTMYCL NAQMVVYGTK TEKGSAVARR PMGWLSLMVG       120
     GLRLSGMFI                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page