(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE90

PENCW_10.PE90        Location/Qualifiers
FT   CDS             complement(218767..218922)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671898"
FT                   /orf_name="Pc13g00900"
FT                   /product="Pc13g00900 protein"
FT                   /protein_id="CAP91159.1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831043"
FT                   /db_xref="UniProtKB/TrEMBL:B6H196"
FT                   /transl_table=1
FT                   /translation="MRCRACQSKGVKRDLPRPRCSNCLDEQILCFYVAPLRLTMARSKK
FT                   QRSACT"
     MRCRACQSKG VKRDLPRPRC SNCLDEQILC FYVAPLRLTM ARSKKQRSAC T                 51
//

If you have problems or comments...

PBIL Back to PBIL home page