(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE91

PENCW_10.PE91        Location/Qualifiers
FT   CDS             join(complement(221746..222025),complement(220889..221697))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948719"
FT                   /orf_name="Pc13g00910"
FT                   /product="Pc13g00910 protein"
FT                   /protein_id="CAP91160.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001831044"
FT                   /db_xref="UniProtKB/TrEMBL:B6H197"
FT                   /transl_table=1
FT                   /translation="MSAGGIMDGRIPDLQALPTEILHLILTSLESWEIKAFSLVNRRLR
FT                   DVCLPYLFYRVRFNFSEAGLDGLQQLRHSVVRLHVKSLNYTVPELIKPDILSFETFKSE
FT                   MLTPKSYVEEAKELYDCGYPADECPPYMVIYETLRTICENQQEILENHKNIDVLSSVLA
FT                   ALPRLRELELDFCPSIDEPQWVDSYLSLGMTAKEVSNTYHIQAVTKALQRRPECIAPLV
FT                   TIELSSLDLPHYSSWELPKFPSLSGALELLLEHCTTLRITGDSAPLELLSRSTVKLRKL
FT                   ILGHVNISYTAWREFLETNRQTIISIGFYDTHLIRGLAEIQELSPKLLPAVLPGFAFST
FT                   KKSTDYWKMPYWETGWIIQLGS"
     MSAGGIMDGR IPDLQALPTE ILHLILTSLE SWEIKAFSLV NRRLRDVCLP YLFYRVRFNF        60
     SEAGLDGLQQ LRHSVVRLHV KSLNYTVPEL IKPDILSFET FKSEMLTPKS YVEEAKELYD       120
     CGYPADECPP YMVIYETLRT ICENQQEILE NHKNIDVLSS VLAALPRLRE LELDFCPSID       180
     EPQWVDSYLS LGMTAKEVSN TYHIQAVTKA LQRRPECIAP LVTIELSSLD LPHYSSWELP       240
     KFPSLSGALE LLLEHCTTLR ITGDSAPLEL LSRSTVKLRK LILGHVNISY TAWREFLETN       300
     RQTIISIGFY DTHLIRGLAE IQELSPKLLP AVLPGFAFST KKSTDYWKMP YWETGWIIQL       360
     GS                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page