(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE92

PENCW_10.PE92        Location/Qualifiers
FT   CDS             complement(223238..226462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948720"
FT                   /orf_name="Pc13g00920"
FT                   /product="Pc13g00920 protein"
FT                   /protein_id="CAP91161.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI000183042F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H198"
FT                   /transl_table=1
FT                   /translation="MARIDLHTVDTLQLYAPRASTVDRKTVKGKILSGEAFSDFSRTER
FT                   ATIWKNLRSQAACDGIIPSLHTFFRDINYLELCANAVKRLVVLNKQRPTVRSALVHGFR
FT                   SRRADHGCLIQTSDTTFRRQPGSSDEGLTSGYRQIWMYAMRHYPEMAKDVQGGPKANPT
FT                   RAKARAKADESVIHAMAALAKKLGFRTPPVKTIIRQSPDHQIARAALLKARKPDHYHYD
FT                   SGAFESLIEQIAGCFALAIPNEAAPVAHITSRVIKLKDRCGIPQEQTQQLDSPHIFLDT
FT                   LHSATVLQRNLSSLEVRRSVYYAFFGKSSATTSQSVPLGQSSSNDPLSPLFVPTDVPRL
FT                   QSESAHDHMSRSSFDEGSSNGRRDRSEIPEEQHRRQERQHAVEHGPLLVQEPSIQSSIG
FT                   ETSTISEVMDMYWDSSGAEDQPRPENVEQQPAASRGMDSDSEERECTEIDEEDLLRRAA
FT                   DGGPVLEDAAAVNHLTLGAPRDTDMSSILDEGAGGVDMDEDMNSSAQNQSVQDRLGMPT
FT                   TLSRQSSTTPPASRKKSRDTTWKPYDATQKGNRKATTKPLAAQGQSIAEGGMTNSEPSA
FT                   EQRSGLGPLQPIAEHAEQEITRPVNEPEYPEHISGGPLPAEAQEGIAGEQMVDGTELIA
FT                   EAGEEVHQGDRVARERADALTQLQTSGAREDHAPRPVTELPADLPSLITRLREEGSQLG
FT                   DEGVIPDNIGMQELPELKPATVDNLDGVGGGTAVGVVKPGLSQQETERHRADLPNPEQA
FT                   QRQAIERQEGEDLLFDVPVLEEPTDQAVEEDPGRPTLEVPDPLRPGSMPAGLSSDVPPE
FT                   RRVTVTFYVYERQAWKKMDMVTVSPTQLADAQIIAERYARDPSQYARFYDGRLRKVAVN
FT                   ECIRAAIDDGSFTVLMSFGKDLMVTRHLVASVAEIFKSTGSEWHNPYHPEKRLKANTGA
FT                   PSAGPVQTRKDASSRKTERRGRKITPRIADGPPQDVRPSRARSEADSQPVTIVFRVRDE
FT                   NGRWRVAYEVRVDDRSNPSQVEQLARKEARDRQATFYDKNLRKLTPTQCFEAAIEDDTN
FT                   TIFMNFGGELRMDEDTIRSIAREVEL"
     MARIDLHTVD TLQLYAPRAS TVDRKTVKGK ILSGEAFSDF SRTERATIWK NLRSQAACDG        60
     IIPSLHTFFR DINYLELCAN AVKRLVVLNK QRPTVRSALV HGFRSRRADH GCLIQTSDTT       120
     FRRQPGSSDE GLTSGYRQIW MYAMRHYPEM AKDVQGGPKA NPTRAKARAK ADESVIHAMA       180
     ALAKKLGFRT PPVKTIIRQS PDHQIARAAL LKARKPDHYH YDSGAFESLI EQIAGCFALA       240
     IPNEAAPVAH ITSRVIKLKD RCGIPQEQTQ QLDSPHIFLD TLHSATVLQR NLSSLEVRRS       300
     VYYAFFGKSS ATTSQSVPLG QSSSNDPLSP LFVPTDVPRL QSESAHDHMS RSSFDEGSSN       360
     GRRDRSEIPE EQHRRQERQH AVEHGPLLVQ EPSIQSSIGE TSTISEVMDM YWDSSGAEDQ       420
     PRPENVEQQP AASRGMDSDS EERECTEIDE EDLLRRAADG GPVLEDAAAV NHLTLGAPRD       480
     TDMSSILDEG AGGVDMDEDM NSSAQNQSVQ DRLGMPTTLS RQSSTTPPAS RKKSRDTTWK       540
     PYDATQKGNR KATTKPLAAQ GQSIAEGGMT NSEPSAEQRS GLGPLQPIAE HAEQEITRPV       600
     NEPEYPEHIS GGPLPAEAQE GIAGEQMVDG TELIAEAGEE VHQGDRVARE RADALTQLQT       660
     SGAREDHAPR PVTELPADLP SLITRLREEG SQLGDEGVIP DNIGMQELPE LKPATVDNLD       720
     GVGGGTAVGV VKPGLSQQET ERHRADLPNP EQAQRQAIER QEGEDLLFDV PVLEEPTDQA       780
     VEEDPGRPTL EVPDPLRPGS MPAGLSSDVP PERRVTVTFY VYERQAWKKM DMVTVSPTQL       840
     ADAQIIAERY ARDPSQYARF YDGRLRKVAV NECIRAAIDD GSFTVLMSFG KDLMVTRHLV       900
     ASVAEIFKST GSEWHNPYHP EKRLKANTGA PSAGPVQTRK DASSRKTERR GRKITPRIAD       960
     GPPQDVRPSR ARSEADSQPV TIVFRVRDEN GRWRVAYEVR VDDRSNPSQV EQLARKEARD      1020
     RQATFYDKNL RKLTPTQCFE AAIEDDTNTI FMNFGGELRM DEDTIRSIAR EVEL            1074
//

If you have problems or comments...

PBIL Back to PBIL home page