(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE93

PENCW_10.PE93        Location/Qualifiers
FT   CDS             join(complement(226959..227338),complement(226532..226871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128946"
FT                   /orf_name="Pc13g00930"
FT                   /product="Pc13g00930 protein"
FT                   /protein_id="CAP91162.1"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniParc:UPI0001830430"
FT                   /db_xref="UniProtKB/TrEMBL:B6H199"
FT                   /transl_table=1
FT                   /translation="MDLLTDTERQLTAERLFKYQGTAKIDLDQISLQPLMSREIDQKNV
FT                   ERLHNIFAKDGCQRFDIRNHVTAVVSRRHLERACRGAGLTPEELKTYQREYPHLSFRGH
FT                   QVQCLHGQHRLTAAEETLAPSDRPDLRTALVDEYANEKAPTDGEVYRKIRQYQHESNAL
FT                   FQNRWWCRLSPNKAKRLRQLTSKDNTYLCAAFDALLAIPGLWNGLSLGSLNTVMALKCD
FT                   EVGSTPRSLKAIPDSSS"
     MDLLTDTERQ LTAERLFKYQ GTAKIDLDQI SLQPLMSREI DQKNVERLHN IFAKDGCQRF        60
     DIRNHVTAVV SRRHLERACR GAGLTPEELK TYQREYPHLS FRGHQVQCLH GQHRLTAAEE       120
     TLAPSDRPDL RTALVDEYAN EKAPTDGEVY RKIRQYQHES NALFQNRWWC RLSPNKAKRL       180
     RQLTSKDNTY LCAAFDALLA IPGLWNGLSL GSLNTVMALK CDEVGSTPRS LKAIPDSSS        239
//

If you have problems or comments...

PBIL Back to PBIL home page