(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE94

PENCW_10.PE94        Location/Qualifiers
FT   CDS             join(227642..228199,228352..228600,228648..228758)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977828"
FT                   /orf_name="Pc13g00940"
FT                   /product="Pc13g00940 protein"
FT                   /protein_id="CAP91163.1"
FT                   /db_xref="UniParc:UPI0001830431"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A0"
FT                   /transl_table=1
FT                   /translation="MDDRHLTQLYAESFKAQRPLSPTPTTVSAHKEFQGQSNHKLTKGR
FT                   KQQEKPEKSKNPLFGPAQDVRQSSSQSERQTAQAPVIRRGSPWHILKDLFTCDLAGPVS
FT                   IAVHKKGPSEVIAVRAFSKEKADVWLQVIQQTQHPNVISATEIFKDLGMTYFIVDDLPL
FT                   TLEHLVACDIFPSELQLASILVQVIPIPLFHLLTNMTAGLEHCIGRQPTQSQAQTLRAL
FT                   TNVTMFLMQKYLKPDGVIGIDGTRWRSDPLEFLSATASVATIQELRKHPLLTKHRWSAG
FT                   TLVGLARLCLITTRTFITKPWVQN"
     MDDRHLTQLY AESFKAQRPL SPTPTTVSAH KEFQGQSNHK LTKGRKQQEK PEKSKNPLFG        60
     PAQDVRQSSS QSERQTAQAP VIRRGSPWHI LKDLFTCDLA GPVSIAVHKK GPSEVIAVRA       120
     FSKEKADVWL QVIQQTQHPN VISATEIFKD LGMTYFIVDD LPLTLEHLVA CDIFPSELQL       180
     ASILVQVIPI PLFHLLTNMT AGLEHCIGRQ PTQSQAQTLR ALTNVTMFLM QKYLKPDGVI       240
     GIDGTRWRSD PLEFLSATAS VATIQELRKH PLLTKHRWSA GTLVGLARLC LITTRTFITK       300
     PWVQN                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page