(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE95

PENCW_10.PE95        Location/Qualifiers
FT   CDS             join(complement(230709..230723),complement(230610..230657),
FT                   complement(230434..230518),complement(228977..230163))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948721"
FT                   /orf_name="Pc13g00950"
FT                   /product="Pc13g00950 protein"
FT                   /protein_id="CAP91164.1"
FT                   /db_xref="UniParc:UPI0001830432"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A1"
FT                   /transl_table=1
FT                   /translation="MSSLPIHPRDVLSLNEDTCADLLQEAQMIESFEVQENRSNAEVDP
FT                   LESLGAVTSPKSDAAYPTPPLSVASPPLTSSNGRITQHQPIGTPLSTDSPYASLETTPT
FT                   GPATPFGSDAIYSSYPTPSTSYVNSPPAEESCTLQGLRIPSQSRFRYLQSGRAGKNGTD
FT                   FLEQIKIEKILSAEDSLLAQEPSRLLQPLLECSEAGILPSLKALRLPVEWKGKGGAVKY
FT                   YRLLEAVKEKTLVLSPLAKRIAQILFYLNCTWLEKHGQLGATVATFILNACPEEPNTPE
FT                   RMKSRRDNITGCHKRPGKRCWMLVACLGAGVLLHGADAIDTVYVPQRRLRSPQLTRTCS
FT                   INSNFTIPQLNIFITFVLRTRPGTVHLLRSLDTVVEAIMLGASIADLRGVFRGITDATV
FT                   RQAQLASASAADQEAWTEQMTEDIWQAMDAESIAKKKIPDIIRDF"
     MSSLPIHPRD VLSLNEDTCA DLLQEAQMIE SFEVQENRSN AEVDPLESLG AVTSPKSDAA        60
     YPTPPLSVAS PPLTSSNGRI TQHQPIGTPL STDSPYASLE TTPTGPATPF GSDAIYSSYP       120
     TPSTSYVNSP PAEESCTLQG LRIPSQSRFR YLQSGRAGKN GTDFLEQIKI EKILSAEDSL       180
     LAQEPSRLLQ PLLECSEAGI LPSLKALRLP VEWKGKGGAV KYYRLLEAVK EKTLVLSPLA       240
     KRIAQILFYL NCTWLEKHGQ LGATVATFIL NACPEEPNTP ERMKSRRDNI TGCHKRPGKR       300
     CWMLVACLGA GVLLHGADAI DTVYVPQRRL RSPQLTRTCS INSNFTIPQL NIFITFVLRT       360
     RPGTVHLLRS LDTVVEAIML GASIADLRGV FRGITDATVR QAQLASASAA DQEAWTEQMT       420
     EDIWQAMDAE SIAKKKIPDI IRDF                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page