(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE96

PENCW_10.PE96        Location/Qualifiers
FT   CDS             join(complement(232723..233298),complement(231875..232675),
FT                   complement(231575..231814))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948722"
FT                   /orf_name="Pc13g00960"
FT                   /product="Pc13g00960 protein"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91165.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI0001830433"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A2"
FT                   /transl_table=1
FT                   /translation="MDYKGCLCCMSSYPYSCCLVPLTVSPFRRMDPLVIYAITAGGIFA
FT                   VLLLIRTISLLAGCGHLFSLIVSQHLTLPFVIRRHRFLGPWTRAGVFLHLSYAAINIFL
FT                   LFFRIKSLTGAGRRAGELALVNLIFPLSTIHLAYLADLLGIKWNSCRKIHRATGWMAVA
FT                   LLSFHIIAAVQGQGFTFPLREQQNLFTMLAAISLGALALHSIPWFRQWSYEVFLRGHQI
FT                   LAGLFVYGTWQHLPLQSASSKIYLFVAVGTFVLTFLLELITLLYNNGLFAGNGTPRAIV
FT                   SFSAMESKEGLVVNAVHIRVLLPRRVKVQAGQYINLWMPSVSLCSWMQTHPFTVTSWSK
FT                   GKQDTVELLVKPCSGFTADLLRHAPAAAGSSVSFLALFTGPHGVSEKVSNYESILLLAS
FT                   GSGIAVAIPYLKKMIYGYNTCTSQVRRLHLVWQVESVDKMTPALSLINNLLKDDIMDDG
FT                   YILHISIYVSDGIEQNGLPFGRHKRVYIYQEVPDWQSIISLEASGNQVERLPNTWDEQG
FT                   RTLVMGEVPNFPRRIRANRPG"
     MDYKGCLCCM SSYPYSCCLV PLTVSPFRRM DPLVIYAITA GGIFAVLLLI RTISLLAGCG        60
     HLFSLIVSQH LTLPFVIRRH RFLGPWTRAG VFLHLSYAAI NIFLLFFRIK SLTGAGRRAG       120
     ELALVNLIFP LSTIHLAYLA DLLGIKWNSC RKIHRATGWM AVALLSFHII AAVQGQGFTF       180
     PLREQQNLFT MLAAISLGAL ALHSIPWFRQ WSYEVFLRGH QILAGLFVYG TWQHLPLQSA       240
     SSKIYLFVAV GTFVLTFLLE LITLLYNNGL FAGNGTPRAI VSFSAMESKE GLVVNAVHIR       300
     VLLPRRVKVQ AGQYINLWMP SVSLCSWMQT HPFTVTSWSK GKQDTVELLV KPCSGFTADL       360
     LRHAPAAAGS SVSFLALFTG PHGVSEKVSN YESILLLASG SGIAVAIPYL KKMIYGYNTC       420
     TSQVRRLHLV WQVESVDKMT PALSLINNLL KDDIMDDGYI LHISIYVSDG IEQNGLPFGR       480
     HKRVYIYQEV PDWQSIISLE ASGNQVERLP NTWDEQGRTL VMGEVPNFPR RIRANRPG         538
//

If you have problems or comments...

PBIL Back to PBIL home page