(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE97

PENCW_10.PE97        Location/Qualifiers
FT   CDS             233495..233746
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948723"
FT                   /orf_name="Pc13g00970"
FT                   /product="Pc13g00970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91166.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001830434"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A3"
FT                   /transl_table=1
FT                   /translation="MSKTEQKSSWVKKRRSESSRAKSQQRQRRKSGLFKKAAEFSLECE
FT                   SDVVVAIRIRRTGQTYIFDSSSQEEWLEALPRLVLYPP"
     MSKTEQKSSW VKKRRSESSR AKSQQRQRRK SGLFKKAAEF SLECESDVVV AIRIRRTGQT        60
     YIFDSSSQEE WLEALPRLVL YPP                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page