(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE98

PENCW_10.PE98        Location/Qualifiers
FT   CDS             join(234510..234512,234567..234625,234676..234922,
FT                   234975..235034,235086..235138,235188..235386,
FT                   235433..235552,235681..235785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948724"
FT                   /orf_name="Pc13g00980"
FT                   /product="Pc13g00980 protein"
FT                   /protein_id="CAP91167.1"
FT                   /db_xref="UniParc:UPI0001830435"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1A4"
FT                   /transl_table=1
FT                   /translation="MSLRQIYPPFGENPSGQATIDIIAVHGLDFIDMSGRCSVSSWREP
FT                   LDESGEFWPVAFIRAHGLRARLLLYEFDSVMTFGAAPESVSREADGLLHQISTIRPTDH
FT                   PDAPIIFLSHGLGGILVKQALVNASQGDRYCGINNATRGLAFFGTPHQAPSHRSPGVIE
FT                   TVFSLVSPRIPIRSPYSPELPIVQGFRDQVEDYQFISFYGDSDEAVPFSSAVMNLAGNR
FT                   ETQVRLSSNHEDLCRFYQGSDNYRKIANFSDLWTASPANFASTGEYSPDQSVSVLPNRL
FT                   "
     MSLRQIYPPF GENPSGQATI DIIAVHGLDF IDMSGRCSVS SWREPLDESG EFWPVAFIRA        60
     HGLRARLLLY EFDSVMTFGA APESVSREAD GLLHQISTIR PTDHPDAPII FLSHGLGGIL       120
     VKQALVNASQ GDRYCGINNA TRGLAFFGTP HQAPSHRSPG VIETVFSLVS PRIPIRSPYS       180
     PELPIVQGFR DQVEDYQFIS FYGDSDEAVP FSSAVMNLAG NRETQVRLSS NHEDLCRFYQ       240
     GSDNYRKIAN FSDLWTASPA NFASTGEYSP DQSVSVLPNR L                           281
//

If you have problems or comments...

PBIL Back to PBIL home page