(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE1

PENCW_13.PE1         Location/Qualifiers
FT   CDS             join(complement(1486..1629),complement(983..1384))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19823842"
FT                   /orf_name="Pc16g00010"
FT                   /product="Putative uncharacterized protein Pc16g00010 "
FT                   /protein_id="CAP92671.1"
FT                   /db_xref="UniParc:UPI0001831CCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6R5"
FT                   /transl_table=1
FT                   /translation="MSLSFSKKWPTLYGDFAVHGPPPYKNCPPEQFLATSTAFCIFTPQ
FT                   MGSCWGGSPTAVVSSGTQQRLIPPMTSSPRSALGPLGGHSAPGLVVMGALAELLPGASA
FT                   VVTEARGPFGARHRWSLWIDGRWPYPKPRFLEGAAPWDPPFAGVVHGVWTLHPRATCRS
FT                   LPAPSRAPGPDPLRADWC"
     MSLSFSKKWP TLYGDFAVHG PPPYKNCPPE QFLATSTAFC IFTPQMGSCW GGSPTAVVSS        60
     GTQQRLIPPM TSSPRSALGP LGGHSAPGLV VMGALAELLP GASAVVTEAR GPFGARHRWS       120
     LWIDGRWPYP KPRFLEGAAP WDPPFAGVVH GVWTLHPRAT CRSLPAPSRA PGPDPLRADW       180
     C                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page