(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE100

PENCW_13.PE100       Location/Qualifiers
FT   CDS             join(227898..227942,228073..228194,228252..228277,
FT                   228319..228375,228412..228455,228591..228716,
FT                   228844..228869,229059..229122,229168..229179,
FT                   229657..229696,229817..229959,229994..230056)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977301"
FT                   /orf_name="Pc16g01000"
FT                   /product="Putative uncharacterized protein Pc16g01000 "
FT                   /protein_id="CAP92770.1"
FT                   /db_xref="UniParc:UPI00018313F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H702"
FT                   /transl_table=1
FT                   /translation="MDSYCRLCPPLITTLLVGVEWKNVLQHGDVLSSTYNRNGAKEKRG
FT                   AIIQDRQRVELIPVRPRSHIITRTSQKVLELARTVIIQSYRFTSSKTGGGPPSLSIPSL
FT                   ESVHSLVSGPSAPTIRDLHVCGLLSRVPGQFGFTDPRFSMLFFIFESPTLDQEQANYLA
FT                   EYYLPTSLLPWAGRHSPGELPILEVRDLEGLKWPHRITYSASYGTSSFGTDSHPHYNYE
FT                   IEYHQPTRDKQLEEGTMAITTLDFCGSYGSSSA"
     MDSYCRLCPP LITTLLVGVE WKNVLQHGDV LSSTYNRNGA KEKRGAIIQD RQRVELIPVR        60
     PRSHIITRTS QKVLELARTV IIQSYRFTSS KTGGGPPSLS IPSLESVHSL VSGPSAPTIR       120
     DLHVCGLLSR VPGQFGFTDP RFSMLFFIFE SPTLDQEQAN YLAEYYLPTS LLPWAGRHSP       180
     GELPILEVRD LEGLKWPHRI TYSASYGTSS FGTDSHPHYN YEIEYHQPTR DKQLEEGTMA       240
     ITTLDFCGSY GSSSA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page