(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE101

PENCW_13.PE101       Location/Qualifiers
FT   CDS             join(230820..231078,231170..231551,231603..232521,
FT                   232582..233070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824070"
FT                   /orf_name="Pc16g01010"
FT                   /product="Pc16g01010 protein"
FT                   /protein_id="CAP92771.1"
FT                   /db_xref="UniParc:UPI00018313F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H703"
FT                   /transl_table=1
FT                   /translation="MAEENPRKSIVEDVFIPKELLTTAKFNSPWELARWEQSLPDNDRI
FT                   ISLPEPRTSSNRPLSLSALRSVARPKSAIRSRGRSDPPAFQGTFDYFEKPATFEPPSPI
FT                   PEKGQVTPVQNALLSPQPLSKTSSQTISSEQSHLQEVYEKAKLRGVAIQRKHWVRLLFE
FT                   YSIYALLVLFVYFVLVGMPLWKGAVWWLYWVVRTKFVITGGYAIIIGLAALYAFCPLLI
FT                   LFEKDPPAPDSESESESPDLENNISKVKSTALLIPCYKSASIVGATLEAALKIFPKENI
FT                   FVIANGNSKTPLDNTEEVCKPYGVNHLWVPIGSKIVAQFVGCYAAKDFENAVLIDDDCL
FT                   LPPNFPIVSDRLKKNVKCIGYTIKSVGPNSSKGTFCQQAQDLEYKMSGLQRDFFGKFGS
FT                   ATFPHGAISLWNIEFLKQTFHEHPGFSVSEDWFFGDACRRLGGRITMCSQVFVETETPA
FT                   SVFWSGSGGSRGGFGEMTIFQQRFKRWNFFFVVGVYYDLKYILTSWKLGWWEFGAKLCV
FT                   FQEVYETLIYLFAPFILPISFIVRPSFCGMLLGVTIAMYILNVIIFNEIHLRLKKERVD
FT                   WKVLLFYYTFYKIALTVVNVFSCYWSLYKYARYFAQRHPKVIEDRDAVEVILSLEKESI
FT                   SRRTSVEDDVIPLDGALGRGVGRKLTLTKVQTGKRKMTEESEKGGWV"
     MAEENPRKSI VEDVFIPKEL LTTAKFNSPW ELARWEQSLP DNDRIISLPE PRTSSNRPLS        60
     LSALRSVARP KSAIRSRGRS DPPAFQGTFD YFEKPATFEP PSPIPEKGQV TPVQNALLSP       120
     QPLSKTSSQT ISSEQSHLQE VYEKAKLRGV AIQRKHWVRL LFEYSIYALL VLFVYFVLVG       180
     MPLWKGAVWW LYWVVRTKFV ITGGYAIIIG LAALYAFCPL LILFEKDPPA PDSESESESP       240
     DLENNISKVK STALLIPCYK SASIVGATLE AALKIFPKEN IFVIANGNSK TPLDNTEEVC       300
     KPYGVNHLWV PIGSKIVAQF VGCYAAKDFE NAVLIDDDCL LPPNFPIVSD RLKKNVKCIG       360
     YTIKSVGPNS SKGTFCQQAQ DLEYKMSGLQ RDFFGKFGSA TFPHGAISLW NIEFLKQTFH       420
     EHPGFSVSED WFFGDACRRL GGRITMCSQV FVETETPASV FWSGSGGSRG GFGEMTIFQQ       480
     RFKRWNFFFV VGVYYDLKYI LTSWKLGWWE FGAKLCVFQE VYETLIYLFA PFILPISFIV       540
     RPSFCGMLLG VTIAMYILNV IIFNEIHLRL KKERVDWKVL LFYYTFYKIA LTVVNVFSCY       600
     WSLYKYARYF AQRHPKVIED RDAVEVILSL EKESISRRTS VEDDVIPLDG ALGRGVGRKL       660
     TLTKVQTGKR KMTEESEKGG WV                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page