(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE102

PENCW_13.PE102       Location/Qualifiers
FT   CDS             join(234899..234943,235350..236765)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076652" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128403"
FT                   /orf_name="Pc16g01020"
FT                   /product="Pc16g01020 protein"
FT                   /protein_id="CAP92772.1"
FT                   /db_xref="UniParc:UPI00018313F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H704"
FT                   /transl_table=1
FT                   /translation="MSEDFESLPPAVRRKFFSNVERLRIRLAQSDHGSPTCSTSNYQTD
FT                   NRVYRAPRLGDYHSRGLRTGSRKRGLEKRSSPSKKLRKPGSLQLAYLAAQADSQCFHSL
FT                   PAKIQQKLFSPEERRRLRNAYRQSLIYDAADEAYRRDSGRDSRKSRPSIDTHPSQTIVP
FT                   VVQPSTAFYSDSDSDDEDPNMDQTFHDSFRWLDEDGDLDLSLDEYHAHVADAATKKRTR
FT                   PSFRRSLSFSNHLRKTLEITPTSTRGLPPVSQSQPLTPLSNRTSESRPSSNHRFQHGPK
FT                   SSTSSIDPCAQYYQDPDARLKLRVYLASPQKFDEAIEFGFPSLDQNNKENIGPEPTTPK
FT                   PSSPKFTLVDWDFGTFFEDDDGTMVGSPGGSVENEPIRSPVLTQRDAPRPSMESSALFQ
FT                   RRQSWLPGAKGVPQRLPGNREMTLKMTLTRPDLRTDSPTPPASSKEKEDPLRLAELPPA
FT                   DRSQSIWDSDLDERGVVRKMWRKLRRRV"
     MSEDFESLPP AVRRKFFSNV ERLRIRLAQS DHGSPTCSTS NYQTDNRVYR APRLGDYHSR        60
     GLRTGSRKRG LEKRSSPSKK LRKPGSLQLA YLAAQADSQC FHSLPAKIQQ KLFSPEERRR       120
     LRNAYRQSLI YDAADEAYRR DSGRDSRKSR PSIDTHPSQT IVPVVQPSTA FYSDSDSDDE       180
     DPNMDQTFHD SFRWLDEDGD LDLSLDEYHA HVADAATKKR TRPSFRRSLS FSNHLRKTLE       240
     ITPTSTRGLP PVSQSQPLTP LSNRTSESRP SSNHRFQHGP KSSTSSIDPC AQYYQDPDAR       300
     LKLRVYLASP QKFDEAIEFG FPSLDQNNKE NIGPEPTTPK PSSPKFTLVD WDFGTFFEDD       360
     DGTMVGSPGG SVENEPIRSP VLTQRDAPRP SMESSALFQR RQSWLPGAKG VPQRLPGNRE       420
     MTLKMTLTRP DLRTDSPTPP ASSKEKEDPL RLAELPPADR SQSIWDSDLD ERGVVRKMWR       480
     KLRRRV                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page