(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE103

PENCW_13.PE103       Location/Qualifiers
FT   CDS             join(237423..241267,241326..241950)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946597"
FT                   /orf_name="Pc16g01030"
FT                   /product="Pc16g01030 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92773.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="UniParc:UPI00018313F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H711"
FT                   /transl_table=1
FT                   /translation="MIPRWLLLTLSLLLVWASHPAAAKGNEPNIVTHELDAPPADLFYF
FT                   HGTNTILYRDRRSLTAHVSFDGGEEWETVKGNDGTIEGTVDLIWRHPFDDNRAYILGEN
FT                   GKHWITTDQAKSWRPFQVDVLPFASMRSFPLEFNGWDPKKVIFMGLDCTILGCLPQTFY
FT                   TTDDFETVKPLREMTLQCMWAASRPQFALDIDMPKSTGDRILCVVPGLKGPFEHTRTER
FT                   LIYSDSFFKDDAEGTEAKLDHGKPLSGVSLQIRSVSKYIVARLQSRGTQEQALYVSDDS
FT                   NVWHRAEFGKHRIEEDAYTILESTNYSIQIDVQTTWQDNRMGSLFSSNSNGTYFTQNIE
FT                   HTNEDLNGLVDFERVTGIHGITIVNTVKNWEEAKKSDSNKKKLISSISFDDGRTFQPLK
FT                   ADKDELHLHSMTTYAALHEMPLPDHRMFSSPAPGLVMGVGNTGGHLEDYSKGDLYVSDN
FT                   AGLTWRRALKGPHRYEFGDQGGVITAVLDSSQTDKVQFSIDHGKEWESISLGQKIRPLF
FT                   LVSTPDSTSLKFLLVGTSSDDTTKTLMFFIDFDGLHERECGSGDLEEWTARLNEKGEPD
FT                   CLMGQKQFFQRRKANADCFIKKEFAISGPEFQLCKCSAEDFECDYNFVRSEDRKECVPA
FT                   VPLTPPAGKCKDPSDKYMGPSGWRLIPGNACIREGGEDLEREIERSCSNVTGPPLITDG
FT                   KPRAGKPQTISAKWTNYFYLERQASNNGVDETIMMLTDKYELHVSRDHGRNWKQIHPDE
FT                   KFIEMVQHPYFSDTAFFLTDGKRVYYTINHGDSFHFFDAPSVPNKEYIRKLAFHEKFQD
FT                   SLIWIGHKDCEGKNCRSQAYVTDKRGASWEPMLIGIADGGCNFGYQEGRNNSEKLVICE
FT                   QYKDEEKNNNRQLVISDDYFSTMEVKFENIARSATKNGFEVVAWYEGDQKEYLNASVSV
FT                   DGRTYANAHFPFNIKVPQYTVLPSSPHALFLLVMVNGGGERSFGSLVKSNSNGTYFVQS
FT                   LEGLNVNDRGYTDYDELQGLEGVAIANVVSNREEVLNKGAAKKLRTMITHNDGGQWMLL
FT                   APPSKDVDGKNFDCSVTEGKGTEKCALHFHGYTERRDYRDTLYSGSAIGLMLALGNVGE
FT                   HLTSASEADTYLTRDGGISWTQVKKGQYMWEFGAAGSVIVLVSDRKATKVVHYTLDEGM
FT                   SWHEFQFAEKELVIDDISTVPSDTSKKFLLWGIDGGKRVIVTLDFSGIWSRDCNDDESD
FT                   YYNWAPTHPFQEENCIFGHVEEYHRKKPAAECWNAWREPHIHSIGRNCTCTRADFECDY
FT                   NYEIQTDGSCGLVPGLQPQDHVAQCSQDPDKVEYWEPTGYRRIPQTTCEGGLLLDQDVS
FT                   KPCPNKEEEYQKKHGISGTGLFFAIVTPIAVAVAVGWYAYTHWDGKFGQIRLGDSGGSQ
FT                   SWLSRDSMLVAVPVALIAGIVAVAQSLPLLVKSLARSSSGLFGRRGMQRPYATRGSFAA
FT                   RRGDYSSVVDDEDELLGADDFDDEEDQA"
     MIPRWLLLTL SLLLVWASHP AAAKGNEPNI VTHELDAPPA DLFYFHGTNT ILYRDRRSLT        60
     AHVSFDGGEE WETVKGNDGT IEGTVDLIWR HPFDDNRAYI LGENGKHWIT TDQAKSWRPF       120
     QVDVLPFASM RSFPLEFNGW DPKKVIFMGL DCTILGCLPQ TFYTTDDFET VKPLREMTLQ       180
     CMWAASRPQF ALDIDMPKST GDRILCVVPG LKGPFEHTRT ERLIYSDSFF KDDAEGTEAK       240
     LDHGKPLSGV SLQIRSVSKY IVARLQSRGT QEQALYVSDD SNVWHRAEFG KHRIEEDAYT       300
     ILESTNYSIQ IDVQTTWQDN RMGSLFSSNS NGTYFTQNIE HTNEDLNGLV DFERVTGIHG       360
     ITIVNTVKNW EEAKKSDSNK KKLISSISFD DGRTFQPLKA DKDELHLHSM TTYAALHEMP       420
     LPDHRMFSSP APGLVMGVGN TGGHLEDYSK GDLYVSDNAG LTWRRALKGP HRYEFGDQGG       480
     VITAVLDSSQ TDKVQFSIDH GKEWESISLG QKIRPLFLVS TPDSTSLKFL LVGTSSDDTT       540
     KTLMFFIDFD GLHERECGSG DLEEWTARLN EKGEPDCLMG QKQFFQRRKA NADCFIKKEF       600
     AISGPEFQLC KCSAEDFECD YNFVRSEDRK ECVPAVPLTP PAGKCKDPSD KYMGPSGWRL       660
     IPGNACIREG GEDLEREIER SCSNVTGPPL ITDGKPRAGK PQTISAKWTN YFYLERQASN       720
     NGVDETIMML TDKYELHVSR DHGRNWKQIH PDEKFIEMVQ HPYFSDTAFF LTDGKRVYYT       780
     INHGDSFHFF DAPSVPNKEY IRKLAFHEKF QDSLIWIGHK DCEGKNCRSQ AYVTDKRGAS       840
     WEPMLIGIAD GGCNFGYQEG RNNSEKLVIC EQYKDEEKNN NRQLVISDDY FSTMEVKFEN       900
     IARSATKNGF EVVAWYEGDQ KEYLNASVSV DGRTYANAHF PFNIKVPQYT VLPSSPHALF       960
     LLVMVNGGGE RSFGSLVKSN SNGTYFVQSL EGLNVNDRGY TDYDELQGLE GVAIANVVSN      1020
     REEVLNKGAA KKLRTMITHN DGGQWMLLAP PSKDVDGKNF DCSVTEGKGT EKCALHFHGY      1080
     TERRDYRDTL YSGSAIGLML ALGNVGEHLT SASEADTYLT RDGGISWTQV KKGQYMWEFG      1140
     AAGSVIVLVS DRKATKVVHY TLDEGMSWHE FQFAEKELVI DDISTVPSDT SKKFLLWGID      1200
     GGKRVIVTLD FSGIWSRDCN DDESDYYNWA PTHPFQEENC IFGHVEEYHR KKPAAECWNA      1260
     WREPHIHSIG RNCTCTRADF ECDYNYEIQT DGSCGLVPGL QPQDHVAQCS QDPDKVEYWE      1320
     PTGYRRIPQT TCEGGLLLDQ DVSKPCPNKE EEYQKKHGIS GTGLFFAIVT PIAVAVAVGW      1380
     YAYTHWDGKF GQIRLGDSGG SQSWLSRDSM LVAVPVALIA GIVAVAQSLP LLVKSLARSS      1440
     SGLFGRRGMQ RPYATRGSFA ARRGDYSSVV DDEDELLGAD DFDDEEDQA                  1489
//

If you have problems or comments...

PBIL Back to PBIL home page