(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE104

PENCW_13.PE104       Location/Qualifiers
FT   CDS             join(complement(243017..243092),complement(242787..242920),
FT                   complement(242581..242666),complement(242314..242512))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000014707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977302"
FT                   /orf_name="Pc16g01040"
FT                   /product="Pc16g01040 protein"
FT                   /function="cytidine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92774.1"
FT                   /db_xref="GO:0004126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00018314D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H713"
FT                   /transl_table=1
FT                   /translation="MAHTITAQELTTLSTKAIDAKATAYCPYSKFRVGACILTASGEFI
FT                   TGANVENASYPVGTCAERVTIGAAIVAGHRDFKALAVATDIKPAASPCGMCRQFIREFT
FT                   SPSFPVYMYDGEGNHKVMTMEEVGFLSFFSFLFGYISVLYLVDSLLISPVAPRLFRPQP
FT                   S"
     MAHTITAQEL TTLSTKAIDA KATAYCPYSK FRVGACILTA SGEFITGANV ENASYPVGTC        60
     AERVTIGAAI VAGHRDFKAL AVATDIKPAA SPCGMCRQFI REFTSPSFPV YMYDGEGNHK       120
     VMTMEEVGFL SFFSFLFGYI SVLYLVDSLL ISPVAPRLFR PQPS                        164
//

If you have problems or comments...

PBIL Back to PBIL home page