(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE105

PENCW_13.PE105       Location/Qualifiers
FT   CDS             join(243613..243667,243720..244396)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977303"
FT                   /orf_name="Pc16g01050"
FT                   /product="Pc16g01050 protein"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92775.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI00018314DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H714"
FT                   /transl_table=1
FT                   /translation="MFNLGVQVINGQKTFIPLENNPEVHTHLCKNLGVSPSLTFHDILS
FT                   TTPEMLSWIPRPVNALILLCDKPIYLAARSRVEHSIPEYLGSGADEPVLWMKQTIGHAC
FT                   GLMALLHVVTNLENGKYVLAGSELEKIVKRAVGLGPVERARLLYDSRFLEEAHMDAASE
FT                   GSSIVPLPQEECGFHFIAFVKKDGKVWELNGGMNGPLLRGELEGDLLGEEGLDMTVREF
FT                   LSAADTEVHRGMSIIAVNNTM"
     MFNLGVQVIN GQKTFIPLEN NPEVHTHLCK NLGVSPSLTF HDILSTTPEM LSWIPRPVNA        60
     LILLCDKPIY LAARSRVEHS IPEYLGSGAD EPVLWMKQTI GHACGLMALL HVVTNLENGK       120
     YVLAGSELEK IVKRAVGLGP VERARLLYDS RFLEEAHMDA ASEGSSIVPL PQEECGFHFI       180
     AFVKKDGKVW ELNGGMNGPL LRGELEGDLL GEEGLDMTVR EFLSAADTEV HRGMSIIAVN       240
     NTM                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page