(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE108

PENCW_13.PE108       Location/Qualifiers
FT   CDS             join(complement(249327..249425),complement(248410..249270))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946599"
FT                   /orf_name="Pc16g01080"
FT                   /product="Pc16g01080 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92778.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00018314DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H710"
FT                   /transl_table=1
FT                   /translation="MAAEHAIISEPMELPSLPPNQGLEAMKDIIFGSSAGMAGKLIEYP
FT                   FDTVKVRLQSQPEHLPLRYTGPLDCFRQSFRADGLRGLYRGISAPMTGAAVETSCLFFS
FT                   YRLIQDALRATVYPGVEHLPFVALIASGALSGSVTSLVLTPIELVKCRMQVPAESAGLK
FT                   PGPVAIVAGIFRHEGLAGFWRGQMGTLIRETGGSAAWFGGYEGVSSLFRKYNKSDPQFT
FT                   SDSLPIHQQMIAGATAGISYNFLFYPADTIKSRMQTVDISQLPVHAQQQTFWGETKALW
FT                   KQQGLKGMYRGCGITCARSAPSSAFIFTVYEGLRQYFG"
     MAAEHAIISE PMELPSLPPN QGLEAMKDII FGSSAGMAGK LIEYPFDTVK VRLQSQPEHL        60
     PLRYTGPLDC FRQSFRADGL RGLYRGISAP MTGAAVETSC LFFSYRLIQD ALRATVYPGV       120
     EHLPFVALIA SGALSGSVTS LVLTPIELVK CRMQVPAESA GLKPGPVAIV AGIFRHEGLA       180
     GFWRGQMGTL IRETGGSAAW FGGYEGVSSL FRKYNKSDPQ FTSDSLPIHQ QMIAGATAGI       240
     SYNFLFYPAD TIKSRMQTVD ISQLPVHAQQ QTFWGETKAL WKQQGLKGMY RGCGITCARS       300
     APSSAFIFTV YEGLRQYFG                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page