(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE109

PENCW_13.PE109       Location/Qualifiers
FT   CDS             join(250273..250327,250416..250561,250731..250871)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217382" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946600"
FT                   /orf_name="Pc16g01090"
FT                   /product="Pc16g01090 protein"
FT                   /protein_id="CAP92779.1"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniParc:UPI00018314DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H712"
FT                   /transl_table=1
FT                   /translation="MSTSTATPVAPPTGMRKNGKNWHGTKKAFRPTAGLTSYAKRQELK
FT                   KHNDAVKELEREMKEEQEAERKARIQRIKDRREAKEEKLRYEKMAEKMHHKRLDRLKRR
FT                   EKRNKLLSS"
     MSTSTATPVA PPTGMRKNGK NWHGTKKAFR PTAGLTSYAK RQELKKHNDA VKELEREMKE        60
     EQEAERKARI QRIKDRREAK EEKLRYEKMA EKMHHKRLDR LKRREKRNKL LSS              113
//

If you have problems or comments...

PBIL Back to PBIL home page