(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE110

PENCW_13.PE110       Location/Qualifiers
FT   CDS             join(251292..251932,252003..252732)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977304"
FT                   /orf_name="Pc16g01100"
FT                   /product="Pc16g01100 protein"
FT                   /protein_id="CAP92780.1"
FT                   /db_xref="UniParc:UPI00018314DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H705"
FT                   /transl_table=1
FT                   /translation="MEPPYKYAPFSTSRAASATFPSTQTPTRSQDQNQQASGLQSKSED
FT                   FSRFSSQESRQTDRRKSRRSRRNGSDDRQISPKGEHRIGPSPSPRSQEPSTFDSLRSNR
FT                   HKYSKSRDLRFPNPMSHLTSSASARGLLPTWSGGKDKDREGDDGLLRPITRETTRSRWG
FT                   SESTTAMSDGRKGNMLDTPGQHEQLAPICRHEILSMDDLEKVKKRRKLGEEYLRSALTS
FT                   IGTLATDVTRRLDYTYYNLLEKITALNSTISSFQDLSDSASTLLNDFEHETADLDQDIR
FT                   KQLNDLKGFEPQIQKADALEQRMKAGRQRVEELGKRLETVRHEIDNWEQRETEWQTRTS
FT                   RRLRIFWGIVISALLVLVLALVLQNWPQFWSPHPEASRLTASNHSSPSVPPQSEAWDEV
FT                   LGLAGRGSGSDAGPARYPTNLADRREGLDKAGPTSTVRSGHDAAAAKHDALSVLDEL"
     MEPPYKYAPF STSRAASATF PSTQTPTRSQ DQNQQASGLQ SKSEDFSRFS SQESRQTDRR        60
     KSRRSRRNGS DDRQISPKGE HRIGPSPSPR SQEPSTFDSL RSNRHKYSKS RDLRFPNPMS       120
     HLTSSASARG LLPTWSGGKD KDREGDDGLL RPITRETTRS RWGSESTTAM SDGRKGNMLD       180
     TPGQHEQLAP ICRHEILSMD DLEKVKKRRK LGEEYLRSAL TSIGTLATDV TRRLDYTYYN       240
     LLEKITALNS TISSFQDLSD SASTLLNDFE HETADLDQDI RKQLNDLKGF EPQIQKADAL       300
     EQRMKAGRQR VEELGKRLET VRHEIDNWEQ RETEWQTRTS RRLRIFWGIV ISALLVLVLA       360
     LVLQNWPQFW SPHPEASRLT ASNHSSPSVP PQSEAWDEVL GLAGRGSGSD AGPARYPTNL       420
     ADRREGLDKA GPTSTVRSGH DAAAAKHDAL SVLDEL                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page