(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE111

PENCW_13.PE111       Location/Qualifiers
FT   CDS             join(complement(253822..253879),complement(253736..253755),
FT                   complement(253427..253514),complement(252899..253323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128404"
FT                   /orf_name="Pc16g01110"
FT                   /product="Pc16g01110 protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAP92781.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005873"
FT                   /db_xref="UniParc:UPI00018314E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H706"
FT                   /transl_table=1
FT                   /translation="MAEVETAPVVQARHVVYCGVCTLPPEYCEFGGTAKKCEEWLKENE
FT                   SDLWDKLYSEDALNANLSTLSVSAQERAAKDAAKKEAKAAANEARDSERKAASKILIKR
FT                   VERNKRKFVTVVIGLEVFGLENKKIAKDLGKKFATGSSVTRSPAGIEEITVQGDVSDDL
FT                   REWLLEIHGKQIPASNIELIEDKKKKKSEAPMV"
     MAEVETAPVV QARHVVYCGV CTLPPEYCEF GGTAKKCEEW LKENESDLWD KLYSEDALNA        60
     NLSTLSVSAQ ERAAKDAAKK EAKAAANEAR DSERKAASKI LIKRVERNKR KFVTVVIGLE       120
     VFGLENKKIA KDLGKKFATG SSVTRSPAGI EEITVQGDVS DDLREWLLEI HGKQIPASNI       180
     ELIEDKKKKK SEAPMV                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page