(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE112

PENCW_13.PE112       Location/Qualifiers
FT   CDS             join(254050..254274,254497..254562,254811..254933)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671366"
FT                   /orf_name="Pc16g01120"
FT                   /product="Putative uncharacterized protein Pc16g01120 "
FT                   /protein_id="CAP92782.1"
FT                   /db_xref="UniParc:UPI00018314E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H707"
FT                   /transl_table=1
FT                   /translation="MAAVSSGRLSQSGSYVVLNCSLWDHVTCSARNGFFNLTPSPDFWT
FT                   NVTHHDIAYHCQSLLCPTSPEWRGHVPYPPTGFRQLACVIKTLGSEAGEDRVVSSSSSR
FT                   YKGSEHKYLARAVITGLRFASTASPKNQEGFGQ"
     MAAVSSGRLS QSGSYVVLNC SLWDHVTCSA RNGFFNLTPS PDFWTNVTHH DIAYHCQSLL        60
     CPTSPEWRGH VPYPPTGFRQ LACVIKTLGS EAGEDRVVSS SSSRYKGSEH KYLARAVITG       120
     LRFASTASPK NQEGFGQ                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page