(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE113

PENCW_13.PE113       Location/Qualifiers
FT   CDS             join(complement(256094..256195),complement(255928..255931),
FT                   complement(255852..255863),complement(255741..255807),
FT                   complement(255485..255629))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977305"
FT                   /orf_name="Pc16g01130"
FT                   /product="Putative uncharacterized protein Pc16g01130 "
FT                   /protein_id="CAP92783.1"
FT                   /db_xref="UniParc:UPI00018314E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H708"
FT                   /transl_table=1
FT                   /translation="MTVPGFLGGFWGIGGIGEVKGKKANNKFGFKEDQEVLYLDHLDRT
FT                   INRFFSTGYASGFLVGIFEDGYYKLPTYVTGIIYGIIGVSREPGPEPMHQGLSTLVFER
FT                   ESDPF"
     MTVPGFLGGF WGIGGIGEVK GKKANNKFGF KEDQEVLYLD HLDRTINRFF STGYASGFLV        60
     GIFEDGYYKL PTYVTGIIYG IIGVSREPGP EPMHQGLSTL VFERESDPF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page