(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE114

PENCW_13.PE114       Location/Qualifiers
FT   CDS             join(256421..257010,257089..258076)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977306"
FT                   /orf_name="Pc16g01140"
FT                   /product="Pc16g01140 protein"
FT                   /protein_id="CAP92784.1"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI00018314E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H716"
FT                   /transl_table=1
FT                   /translation="MTTLLTPRETHSPFSDPLRCPTGPTAQRYFLEDHAIPRKSPMQDD
FT                   YRARDSSPVASNLPSALPSPGFAPIPEQLAYASTLNSLSPENELALPSYDTESLHNPKG
FT                   PEDVSDASTDSHPPSWTLQAPSADDTLIEDEPSRHVDYLSHDWKEEDIWSSWRYVTSRR
FT                   NDYSNGVRLENASWRTWAKAKHNLKTVSPESLNWLKDCDVTWLYGPLKSSVERATSLSP
FT                   PPSRLETPNSYLDRKPILKKKTASEAILQRSLSQHTLLQHAGAILKAQEAENNWARPPF
FT                   PRSNTDLDHLHHRTGSSTYSLGGTLTASSSSGMTSPSERRHIHFNNEVVQCIAVEAKGY
FT                   EDDWPATFEDEPSSDDGVVLMRQISSRSSLSNCTTPRNSFNDGKTIAPLPSTTLKYRGD
FT                   PPGAQTILDRWSTPTRTLSPTPSVETIRPSEPSGQSEPSEPSANFLLDECEDPSLDFTG
FT                   NYPDRDRAWFIEDDPASGRPLRLTASGMIMPEGESESPSSSILDRVVDTVNTARDIAHV
FT                   IWNVGWRR"
     MTTLLTPRET HSPFSDPLRC PTGPTAQRYF LEDHAIPRKS PMQDDYRARD SSPVASNLPS        60
     ALPSPGFAPI PEQLAYASTL NSLSPENELA LPSYDTESLH NPKGPEDVSD ASTDSHPPSW       120
     TLQAPSADDT LIEDEPSRHV DYLSHDWKEE DIWSSWRYVT SRRNDYSNGV RLENASWRTW       180
     AKAKHNLKTV SPESLNWLKD CDVTWLYGPL KSSVERATSL SPPPSRLETP NSYLDRKPIL       240
     KKKTASEAIL QRSLSQHTLL QHAGAILKAQ EAENNWARPP FPRSNTDLDH LHHRTGSSTY       300
     SLGGTLTASS SSGMTSPSER RHIHFNNEVV QCIAVEAKGY EDDWPATFED EPSSDDGVVL       360
     MRQISSRSSL SNCTTPRNSF NDGKTIAPLP STTLKYRGDP PGAQTILDRW STPTRTLSPT       420
     PSVETIRPSE PSGQSEPSEP SANFLLDECE DPSLDFTGNY PDRDRAWFIE DDPASGRPLR       480
     LTASGMIMPE GESESPSSSI LDRVVDTVNT ARDIAHVIWN VGWRR                       525
//

If you have problems or comments...

PBIL Back to PBIL home page