(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE115

PENCW_13.PE115       Location/Qualifiers
FT   CDS             join(258658..258924,259016..260390,260471..260925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128405"
FT                   /orf_name="Pc16g01150"
FT                   /product="Pc16g01150 protein"
FT                   /function="binding"
FT                   /biological_process="phagocytosis"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAP92785.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0006909"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018314E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H717"
FT                   /transl_table=1
FT                   /translation="METVNVAELVERLGSDEDAVRKMAVFKLQGNIGDPSFADIFIAEG
FT                   GLVRLRYLTLHASGNTLAYSLASFSRLLDVDKGWECVDQELVERIVELIVTHPLVNILR
FT                   GAMSILVSIVSHPYTGNRTSQVNNFGFRALKPAIAIYPQFLEMLVSRLSSADHALCANA
FT                   LQLINSLMRDSITHDPEAEWPKFIQKLQDLGVIRAVYVLMQDSALQDLAHPLLEFQSLT
FT                   KVLLRKWRDIPVNQEKPEHRRALKGIYLASNPEKNSDEATENGDSARPSRRHHPEKWRR
FT                   LGFETESPAGEFYEVGFLGMMDLADYVRSHGDEFQNMLLEHSTKPSRQRCPIARASLAV
FT                   TSILYEHFEVEKSDMDDTKTYLISESRTGFDKLFQPLLLHWTRLHVAGLQAFFRLWKAT
FT                   AAEEEDLDKLIELVRILIGSVVGGAARIKDVQDVEEELADFEYHRLRGLQMELLELTYE
FT                   DAWGQHLRQVREELHHEALQFVKEQRIRSLLQGSWFALDSHPKSESGPVQKSTATYQYA
FT                   QLSHNRRYLHFGQFDLMGDRPPELDTLPEKIDLSIVSSVVSNVSTNPDHSSTATVKTAP
FT                   RQPTTKITIHGYVPSTATGHGKGHSHARSGSRTTQKEVVLLTLRPSSHIIASEWLDGLL
FT                   MLLNQQPITAETSKLIDLVSDYGLKIRLLNVRFDDATFAGEAPQVPARDGLDEDYYYDV
FT                   FGGV"
     METVNVAELV ERLGSDEDAV RKMAVFKLQG NIGDPSFADI FIAEGGLVRL RYLTLHASGN        60
     TLAYSLASFS RLLDVDKGWE CVDQELVERI VELIVTHPLV NILRGAMSIL VSIVSHPYTG       120
     NRTSQVNNFG FRALKPAIAI YPQFLEMLVS RLSSADHALC ANALQLINSL MRDSITHDPE       180
     AEWPKFIQKL QDLGVIRAVY VLMQDSALQD LAHPLLEFQS LTKVLLRKWR DIPVNQEKPE       240
     HRRALKGIYL ASNPEKNSDE ATENGDSARP SRRHHPEKWR RLGFETESPA GEFYEVGFLG       300
     MMDLADYVRS HGDEFQNMLL EHSTKPSRQR CPIARASLAV TSILYEHFEV EKSDMDDTKT       360
     YLISESRTGF DKLFQPLLLH WTRLHVAGLQ AFFRLWKATA AEEEDLDKLI ELVRILIGSV       420
     VGGAARIKDV QDVEEELADF EYHRLRGLQM ELLELTYEDA WGQHLRQVRE ELHHEALQFV       480
     KEQRIRSLLQ GSWFALDSHP KSESGPVQKS TATYQYAQLS HNRRYLHFGQ FDLMGDRPPE       540
     LDTLPEKIDL SIVSSVVSNV STNPDHSSTA TVKTAPRQPT TKITIHGYVP STATGHGKGH       600
     SHARSGSRTT QKEVVLLTLR PSSHIIASEW LDGLLMLLNQ QPITAETSKL IDLVSDYGLK       660
     IRLLNVRFDD ATFAGEAPQV PARDGLDEDY YYDVFGGV                               698
//

If you have problems or comments...

PBIL Back to PBIL home page