(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE116

PENCW_13.PE116       Location/Qualifiers
FT   CDS             join(261254..261985,262052..263821)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671367"
FT                   /orf_name="Pc16g01160"
FT                   /product="Pc16g01160 protein"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92786.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="UniParc:UPI00018314E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H718"
FT                   /transl_table=1
FT                   /translation="MDGRPPKRQRRSKDSKDEPKIKPKRKPVISDSSSPIEPTEPFALS
FT                   SRPKPSYSRGTTPSTRPPSYSPSPNKKTEASPNQGPKSKSLHSFFQPATEGQRWAPQKT
FT                   EKQSLPPVRGTVDVDLIEDDYDSYDEIFTQHLANERAGMGLTAMSSSQIRQSAPKPAPK
FT                   PKAKAQVKPPRKTTKRFLLSTDRGDGTAKEPLAAQPANEPDRRPWAQRFAPANLGELAV
FT                   HKKKVSDVQHWLEDAFAGRRSERLLVLRGPAGSGKTTTVSLLSESLGYDIVEWKNPPVS
FT                   EFGARDYQSVSAHFEEFLGRGNKFGGLDLEDASELDSQKEEKPRDQRILLIEEFPTMLG
FT                   RASSALTAFRTSLQRYLAASANDHVRGSSGSNHPPIVIIVSETLLGSASSISDNMTVHR
FT                   LLGPTIYNHPGTTILDFNSIAPTFMHKALRSILDREARTSRRMQIPGPGVIDSISEIGD
FT                   IRSAISSLEFLCLKGDDTGRWGGNVAKTKKARGEVALTAMEKESLKMITQREASLGMFH
FT                   AVGKIVYNKRMDPSLIEGDVEILPPPPDYLRHYARPKASQVLVNDLADETGTDVSTFIS
FT                   ALHENYIPSCDGDDFTDCFNDCIDALSDSDILSADHRPGPGARAGIGTGITSFGSGVDV
FT                   LRQEEMSFQVAARGLLFALPYPVKRRVGPGAGRSRAGDAYKMFYPASLRLWREAEEIDG
FT                   LIDSWMNRSLDPFGQQQHLSQNGSDLSGVSSWKSLQVGRSASAYSKDKGDIPSVVTMMP
FT                   RHDLLLHQLPYMAAIRRQDPDCWQLDKITSIRVNQNLRDGIDDMEESPVPGSRMKSSSS
FT                   NGVGPRLAEEKLILSDDDIVD"
     MDGRPPKRQR RSKDSKDEPK IKPKRKPVIS DSSSPIEPTE PFALSSRPKP SYSRGTTPST        60
     RPPSYSPSPN KKTEASPNQG PKSKSLHSFF QPATEGQRWA PQKTEKQSLP PVRGTVDVDL       120
     IEDDYDSYDE IFTQHLANER AGMGLTAMSS SQIRQSAPKP APKPKAKAQV KPPRKTTKRF       180
     LLSTDRGDGT AKEPLAAQPA NEPDRRPWAQ RFAPANLGEL AVHKKKVSDV QHWLEDAFAG       240
     RRSERLLVLR GPAGSGKTTT VSLLSESLGY DIVEWKNPPV SEFGARDYQS VSAHFEEFLG       300
     RGNKFGGLDL EDASELDSQK EEKPRDQRIL LIEEFPTMLG RASSALTAFR TSLQRYLAAS       360
     ANDHVRGSSG SNHPPIVIIV SETLLGSASS ISDNMTVHRL LGPTIYNHPG TTILDFNSIA       420
     PTFMHKALRS ILDREARTSR RMQIPGPGVI DSISEIGDIR SAISSLEFLC LKGDDTGRWG       480
     GNVAKTKKAR GEVALTAMEK ESLKMITQRE ASLGMFHAVG KIVYNKRMDP SLIEGDVEIL       540
     PPPPDYLRHY ARPKASQVLV NDLADETGTD VSTFISALHE NYIPSCDGDD FTDCFNDCID       600
     ALSDSDILSA DHRPGPGARA GIGTGITSFG SGVDVLRQEE MSFQVAARGL LFALPYPVKR       660
     RVGPGAGRSR AGDAYKMFYP ASLRLWREAE EIDGLIDSWM NRSLDPFGQQ QHLSQNGSDL       720
     SGVSSWKSLQ VGRSASAYSK DKGDIPSVVT MMPRHDLLLH QLPYMAAIRR QDPDCWQLDK       780
     ITSIRVNQNL RDGIDDMEES PVPGSRMKSS SSNGVGPRLA EEKLILSDDD IVD              833
//

If you have problems or comments...

PBIL Back to PBIL home page