(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE117

PENCW_13.PE117       Location/Qualifiers
FT   CDS             join(264059..264320,264498..265182,265258..265546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946601"
FT                   /orf_name="Pc16g01170"
FT                   /product="Pc16g01170 protein"
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92787.1"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI00018314E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H719"
FT                   /transl_table=1
FT                   /translation="MLNDHEPSKRGPDDSYLINRTRVSVNPSGNTNFASKSRSRKSDEP
FT                   NYAQLKKDAPGLIAAAAHAAVPSWTSMVLMVSLIFGGCCANVELIRRPPSHIPNQIRSM
FT                   HTGPLITFAQFVLCALFTIPSFLSPSAGPRALFLNRRAIPLRSWVVYTAYFVSVNLLNN
FT                   WAFAYKISVPLHIILRSAGPVASMVIGYLYNGKRYSRGQIASVGMLTVGVAAAAIADAQ
FT                   SKGVSIHIDSDTADTATTVTGFTILALAMVLSAFQGIYADRLYATYGRDHWKEALFYSH
FT                   ALSLPLFLTSCPQLLGQWRVVASSPSLLSHLDSGWALLTQLPVQVAYLAMNALTQYLCI
FT                   RGVHLLSAKSSSLTVTIFLNVRKLVSLLLSIYLFGNHLAGGVLVGAALVFVGGGLYGFE
FT                   GARLRRVAKKAQ"
     MLNDHEPSKR GPDDSYLINR TRVSVNPSGN TNFASKSRSR KSDEPNYAQL KKDAPGLIAA        60
     AAHAAVPSWT SMVLMVSLIF GGCCANVELI RRPPSHIPNQ IRSMHTGPLI TFAQFVLCAL       120
     FTIPSFLSPS AGPRALFLNR RAIPLRSWVV YTAYFVSVNL LNNWAFAYKI SVPLHIILRS       180
     AGPVASMVIG YLYNGKRYSR GQIASVGMLT VGVAAAAIAD AQSKGVSIHI DSDTADTATT       240
     VTGFTILALA MVLSAFQGIY ADRLYATYGR DHWKEALFYS HALSLPLFLT SCPQLLGQWR       300
     VVASSPSLLS HLDSGWALLT QLPVQVAYLA MNALTQYLCI RGVHLLSAKS SSLTVTIFLN       360
     VRKLVSLLLS IYLFGNHLAG GVLVGAALVF VGGGLYGFEG ARLRRVAKKA Q                411
//

If you have problems or comments...

PBIL Back to PBIL home page