(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE12

PENCW_13.PE12        Location/Qualifiers
FT   CDS             join(complement(30437..30616),complement(29516..30379),
FT                   complement(29128..29460))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671085"
FT                   /orf_name="Pc16g00120"
FT                   /product="Pc16g00120 protein"
FT                   /function="catalytic activity"
FT                   /biological_process="cellular amino acid catabolic process "
FT                   /protein_id="CAP92682.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009063"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR015654"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="UniParc:UPI0001831DAA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S0"
FT                   /transl_table=1
FT                   /translation="MSAAPVHVQDITVTSFEVIDLRFPTSLDGVGSDAMHVGTNGSHPY
FT                   IRLKTNQGTLIGEGIAFSNGRGSELICMALDIFARRVVGKSMHELTRDMGKTWRYMVSD
FT                   SQYRWIGPEKSVTHLAVAGVLNAVWDLWGKILGKPVWKIVCDMDPEEVVRCIDFRYITD
FT                   VITPEESVEILKKTQKDKETRLQEALENRAVPAYTTSPGWLAFSGDRMREVLQETIAAG
FT                   YTTFKFKVGTNVEADRERLAAVREVLGYDQGHQIMIDANQVWSVPQAIEYMKRLVEFKP
FT                   VFIEEPTNPDDVLGHATIRRALKPYGVGVATGEAAQNRVTFKQLLQAEATDVCQIDAVR
FT                   LGSVNECLAVMLMALKFNVPCVPHNGAMGLTELTSHLSTIDYIAISGRKSMLENADSHR
FT                   ENLRHPSKIENAHYVTPLDPGYSTGYTHTALEKYTYPSGSFWKSDIGLEIIAQPTGGEL
FT                   "
     MSAAPVHVQD ITVTSFEVID LRFPTSLDGV GSDAMHVGTN GSHPYIRLKT NQGTLIGEGI        60
     AFSNGRGSEL ICMALDIFAR RVVGKSMHEL TRDMGKTWRY MVSDSQYRWI GPEKSVTHLA       120
     VAGVLNAVWD LWGKILGKPV WKIVCDMDPE EVVRCIDFRY ITDVITPEES VEILKKTQKD       180
     KETRLQEALE NRAVPAYTTS PGWLAFSGDR MREVLQETIA AGYTTFKFKV GTNVEADRER       240
     LAAVREVLGY DQGHQIMIDA NQVWSVPQAI EYMKRLVEFK PVFIEEPTNP DDVLGHATIR       300
     RALKPYGVGV ATGEAAQNRV TFKQLLQAEA TDVCQIDAVR LGSVNECLAV MLMALKFNVP       360
     CVPHNGAMGL TELTSHLSTI DYIAISGRKS MLENADSHRE NLRHPSKIEN AHYVTPLDPG       420
     YSTGYTHTAL EKYTYPSGSF WKSDIGLEII AQPTGGEL                               458
//

If you have problems or comments...

PBIL Back to PBIL home page