(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE123

PENCW_13.PE123       Location/Qualifiers
FT   CDS             complement(279781..280620)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977308"
FT                   /orf_name="Pc16g01230"
FT                   /product="Pc16g01230 protein"
FT                   /protein_id="CAP92793.1"
FT                   /db_xref="UniParc:UPI00018315D6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H725"
FT                   /transl_table=1
FT                   /translation="MFEGILSIFDKSSASFQVLSDLHLEVNQQYSSFEIPVCAKYLVLA
FT                   GDVGRLVDYDNYRCFLQKQTDRFELVFLILGNHEFYSDTFAAGLQRARQLEQEHCLNGR
FT                   LILLHRGRYDIPGSHVTILGCTLWSRVPDEARDIVCSRIQDFKRIRDWSVNDHNRSHEA
FT                   DLAWLLSGIESIQIQSKTRSRKQSVLVVTHHAPSLQGTSSPQHANNAWSSAFATDVLSQ
FT                   ISKSSGIKFWVFGHTHYTTEFRNQGIRVVANQRGYVLPWTDSKGPKDGFDIGKVIHV"
     MFEGILSIFD KSSASFQVLS DLHLEVNQQY SSFEIPVCAK YLVLAGDVGR LVDYDNYRCF        60
     LQKQTDRFEL VFLILGNHEF YSDTFAAGLQ RARQLEQEHC LNGRLILLHR GRYDIPGSHV       120
     TILGCTLWSR VPDEARDIVC SRIQDFKRIR DWSVNDHNRS HEADLAWLLS GIESIQIQSK       180
     TRSRKQSVLV VTHHAPSLQG TSSPQHANNA WSSAFATDVL SQISKSSGIK FWVFGHTHYT       240
     TEFRNQGIRV VANQRGYVLP WTDSKGPKDG FDIGKVIHV                              279
//

If you have problems or comments...

PBIL Back to PBIL home page