(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE129

PENCW_13.PE129       Location/Qualifiers
FT   CDS             join(295939..296020,296055..296070,296209..296238,
FT                   296340..296352,296414..296430,296580..296616,
FT                   296972..296978,297070..297120,297323..297338,
FT                   297440..297452,297535..297564)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946606"
FT                   /orf_name="Pc16g01290"
FT                   /product="Putative uncharacterized protein Pc16g01290 "
FT                   /protein_id="CAP92799.1"
FT                   /db_xref="UniParc:UPI00018315D7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H726"
FT                   /transl_table=1
FT                   /translation="MRSSLVKYVIGILGILVDFRIVAVSIINLGDRRLDFIVSYDYKSG
FT                   VRAIYPDSLYSRTIIKKLREVKDILGILVDFRAVAASIIIFSNYKSGVRVGFVLGRLS"
     MRSSLVKYVI GILGILVDFR IVAVSIINLG DRRLDFIVSY DYKSGVRAIY PDSLYSRTII        60
     KKLREVKDIL GILVDFRAVA ASIIIFSNYK SGVRVGFVLG RLS                         103
//

If you have problems or comments...

PBIL Back to PBIL home page