(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE13

PENCW_13.PE13        Location/Qualifiers
FT   CDS             join(30942..31187,31248..32021)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128153"
FT                   /orf_name="Pc16g00130"
FT                   /product="Pc16g00130 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP92683.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831DAB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S2"
FT                   /transl_table=1
FT                   /translation="MVKFILVTGATGFIGAHIVDVLLARGIRVRGATRSLEKGDSMIKA
FT                   RPQHSGRLEFVQIDDFERPGGLVEAVQGVDGVIHTASPFTYNTRNNERELVRPAINGVR
FT                   AVLEAASTNPKIRRIVITSSFASVLDANRKGPLYFTYTGDDWNPLTYEESVDPATNAII
FT                   AYRGSKKFAELEAWKYVQEHSPKFDIVALCPPMTFGPVVHPVSHVDKLNESNLMLWKIA
FT                   NGENPLPVARVPFWIDVRDLAIAHVESLLRNEVGGKRYVPSSPERFSYGLAAKIIAEEF
FT                   PDLKTKVTQEDQVIDESCGLDGQTAAMELGYTYHLFHDTVRDLVSQTISLSERSPSCR"
     MVKFILVTGA TGFIGAHIVD VLLARGIRVR GATRSLEKGD SMIKARPQHS GRLEFVQIDD        60
     FERPGGLVEA VQGVDGVIHT ASPFTYNTRN NERELVRPAI NGVRAVLEAA STNPKIRRIV       120
     ITSSFASVLD ANRKGPLYFT YTGDDWNPLT YEESVDPATN AIIAYRGSKK FAELEAWKYV       180
     QEHSPKFDIV ALCPPMTFGP VVHPVSHVDK LNESNLMLWK IANGENPLPV ARVPFWIDVR       240
     DLAIAHVESL LRNEVGGKRY VPSSPERFSY GLAAKIIAEE FPDLKTKVTQ EDQVIDESCG       300
     LDGQTAAMEL GYTYHLFHDT VRDLVSQTIS LSERSPSCR                              339
//

If you have problems or comments...

PBIL Back to PBIL home page