(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE14

PENCW_13.PE14        Location/Qualifiers
FT   CDS             join(32657..32779,32837..33645,33713..33813,33866..34072,
FT                   34128..34384)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977033"
FT                   /orf_name="Pc16g00140"
FT                   /product="Pc16g00140 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92684.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831DAC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S3"
FT                   /transl_table=1
FT                   /translation="MAWFGYDQGVFSGVLISADFKKHFPQTKESNISGITSSCFSLGAF
FT                   FGAIFAFTLGDRLGRKKTITLGLVCNTIGAVLQIVSWHLPQLIVGRIINGFGMGLTSST
FT                   CPVYQAECSKPRVRGKLVVVGSLSNTAAFCLSNWMNYGLFFQGEALQWRFPLGFQLIFP
FT                   CIVVGALIFVPESPRWLLLQDRHEEALAVIARLEGRRKDVHDPDVTAQFLSIRSALEVE
FT                   RQSQVPMADVLMCRDKTQNLRRLLLSCGTQFMQQFSGVNALGYYLPTLLQESVGLAEEE
FT                   SRLLTAVNGTTYLFSAFCCLAIIDRFGRRKLMLYGSVTMGACYLIAAMCLKTGEGDPSR
FT                   KQQVVTTAMFFLYYFFYGTSFAKVPWVYNSEMNSLGWRTRGAAAATATNWMGGFIVTQF
FT                   TSVGVNTLHWRFYLIFAVIAWSFFPIIFCLYPETSRRTLEDMDEIFIRHPSPIVCGKQE
FT                   LTQRKRPQTFVDAERDRIMENKEFGKETAKGGTTAHYEHV"
     MAWFGYDQGV FSGVLISADF KKHFPQTKES NISGITSSCF SLGAFFGAIF AFTLGDRLGR        60
     KKTITLGLVC NTIGAVLQIV SWHLPQLIVG RIINGFGMGL TSSTCPVYQA ECSKPRVRGK       120
     LVVVGSLSNT AAFCLSNWMN YGLFFQGEAL QWRFPLGFQL IFPCIVVGAL IFVPESPRWL       180
     LLQDRHEEAL AVIARLEGRR KDVHDPDVTA QFLSIRSALE VERQSQVPMA DVLMCRDKTQ       240
     NLRRLLLSCG TQFMQQFSGV NALGYYLPTL LQESVGLAEE ESRLLTAVNG TTYLFSAFCC       300
     LAIIDRFGRR KLMLYGSVTM GACYLIAAMC LKTGEGDPSR KQQVVTTAMF FLYYFFYGTS       360
     FAKVPWVYNS EMNSLGWRTR GAAAATATNW MGGFIVTQFT SVGVNTLHWR FYLIFAVIAW       420
     SFFPIIFCLY PETSRRTLED MDEIFIRHPS PIVCGKQELT QRKRPQTFVD AERDRIMENK       480
     EFGKETAKGG TTAHYEHV                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page