(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE15

PENCW_13.PE15        Location/Qualifiers
FT   CDS             35978..37264
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945510"
FT                   /orf_name="Pc16g00150"
FT                   /product="Pc16g00150 protein"
FT                   /function="ATP binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP92685.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniParc:UPI0001831DAD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S4"
FT                   /transl_table=1
FT                   /translation="MVVELDTTLAELYANNGLPGPIVVDLYRTYTHIDLHDNFPRERMF
FT                   VEDEDPSTYCSEEEDLPRFKKWALNSRTIRHLPMVGPADVILYLPYNSRDNIDRALDQF
FT                   PKHQRPMVKYVDLDSPCMAKDRRMAIKDKKLVYWRPKSWMVGEDCSVPPELSYMLNDKR
FT                   FLIHPEIPTPSLEMVSLLHEDQRDYLVKLQLPFVVKFCRCSSGQGTYIATTEEERRQML
FT                   EAVRRYRERGGVDIQVSEFVGSRKPHYGVNFFVGRDESLQPCFLGATEQVVAKNGVWVG
FT                   GVIDYQAQGDLERRLRNTIAVVARTLQQYSYVGWIGIDVIFDSDDRPLVVDLNARIAAG
FT                   IGIVLFSKHFMSMGLPFAGMETVSFTGPASGIYAALSASIESGKVIVTLSAEVTDTESV
FT                   ASVVFGGRTRDDLNAVADWIRDVLRTCLN"
     MVVELDTTLA ELYANNGLPG PIVVDLYRTY THIDLHDNFP RERMFVEDED PSTYCSEEED        60
     LPRFKKWALN SRTIRHLPMV GPADVILYLP YNSRDNIDRA LDQFPKHQRP MVKYVDLDSP       120
     CMAKDRRMAI KDKKLVYWRP KSWMVGEDCS VPPELSYMLN DKRFLIHPEI PTPSLEMVSL       180
     LHEDQRDYLV KLQLPFVVKF CRCSSGQGTY IATTEEERRQ MLEAVRRYRE RGGVDIQVSE       240
     FVGSRKPHYG VNFFVGRDES LQPCFLGATE QVVAKNGVWV GGVIDYQAQG DLERRLRNTI       300
     AVVARTLQQY SYVGWIGIDV IFDSDDRPLV VDLNARIAAG IGIVLFSKHF MSMGLPFAGM       360
     ETVSFTGPAS GIYAALSASI ESGKVIVTLS AEVTDTESVA SVVFGGRTRD DLNAVADWIR       420
     DVLRTCLN                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page