(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE16

PENCW_13.PE16        Location/Qualifiers
FT   CDS             join(complement(39295..39348),complement(39200..39244),
FT                   complement(39097..39144),complement(38137..39030),
FT                   complement(37998..38071),complement(37863..37944))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977034"
FT                   /orf_name="Pc16g00160"
FT                   /product="Pc16g00160 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92686.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI0001831DAE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S5"
FT                   /transl_table=1
FT                   /translation="MATSLRNIIVVGGSFVGRTTAQELARIVPSTHRVLLTEPHSHFHH
FT                   LFTFPRFAIVPGQEHKAFIPYSGIFNASPNPSSHGVVQARVLSVKPTHIELDREWQGSK
FT                   DVPFDYVVVATGTRLSKPAAMDDDDKASSVEYLQKHQAGVKRSQSILIVGGGAVGVQMA
FT                   ADLKEYYPEKEVTVVQSRPRVMPNFHSGLHDLIKRRFDELGIRLITGSRVTIPPNGFPN
FT                   DGSTFDVQLTNGTTESTQFVILATGQTPNNQLVADLKSSRPDAESVVNPDNGFIRVRPT
FT                   MQFLDEQYSNLFAVGDIADTGAQKAARPGSAQAAVVAKNIQALIEGRAAEDTFAKGPGA
FT                   IHLTLGMKHNVIFRNPNTAEGQTEPWINPKDDGREDMNVEAMWERLGISVDNPRQYHL"
     MATSLRNIIV VGGSFVGRTT AQELARIVPS THRVLLTEPH SHFHHLFTFP RFAIVPGQEH        60
     KAFIPYSGIF NASPNPSSHG VVQARVLSVK PTHIELDREW QGSKDVPFDY VVVATGTRLS       120
     KPAAMDDDDK ASSVEYLQKH QAGVKRSQSI LIVGGGAVGV QMAADLKEYY PEKEVTVVQS       180
     RPRVMPNFHS GLHDLIKRRF DELGIRLITG SRVTIPPNGF PNDGSTFDVQ LTNGTTESTQ       240
     FVILATGQTP NNQLVADLKS SRPDAESVVN PDNGFIRVRP TMQFLDEQYS NLFAVGDIAD       300
     TGAQKAARPG SAQAAVVAKN IQALIEGRAA EDTFAKGPGA IHLTLGMKHN VIFRNPNTAE       360
     GQTEPWINPK DDGREDMNVE AMWERLGISV DNPRQYHL                               398
//

If you have problems or comments...

PBIL Back to PBIL home page