(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE17

PENCW_13.PE17        Location/Qualifiers
FT   CDS             complement(39905..40996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181391" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945511"
FT                   /orf_name="Pc16g00170"
FT                   /product="Pc16g00170 protein"
FT                   /protein_id="CAP92687.1"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI0001831DAF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S7"
FT                   /transl_table=1
FT                   /translation="MPGHFGQKILNTLGLNDHIHHQSSSVRLPGRPALSNDERGLSSPP
FT                   NNGTYPRLCRLSDGTILSSFTRFPDGQRSLRVAKSTDNGRTFEDFSEVTRAAGDVDNMF
FT                   LCEVAPGTILAAFRNHDTGPNGPTHFRITVCRSTDGGRVWQYASQAAEKRPPLGIWEPF
FT                   MRVGRQGEVQLYFSQEFAHNNQCTMLVISRDQGSTWTQPTCLHGDQDPLRDGMCGIAPT
FT                   FDNGREALLMVFETTRYGPFSVEALLSYDDGATWGWRHEVYRPRQGHNAGSPQIASFAD
FT                   GSMATIFMTDEDSNRVEWVKNASIKVVFAGPPVEGRVQWSSPTLVSPASSFWPGIMALD
FT                   HHNVLATYDRGGPLTKTITWHPA"
     MPGHFGQKIL NTLGLNDHIH HQSSSVRLPG RPALSNDERG LSSPPNNGTY PRLCRLSDGT        60
     ILSSFTRFPD GQRSLRVAKS TDNGRTFEDF SEVTRAAGDV DNMFLCEVAP GTILAAFRNH       120
     DTGPNGPTHF RITVCRSTDG GRVWQYASQA AEKRPPLGIW EPFMRVGRQG EVQLYFSQEF       180
     AHNNQCTMLV ISRDQGSTWT QPTCLHGDQD PLRDGMCGIA PTFDNGREAL LMVFETTRYG       240
     PFSVEALLSY DDGATWGWRH EVYRPRQGHN AGSPQIASFA DGSMATIFMT DEDSNRVEWV       300
     KNASIKVVFA GPPVEGRVQW SSPTLVSPAS SFWPGIMALD HHNVLATYDR GGPLTKTITW       360
     HPA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page