(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE170

PENCW_13.PE170       Location/Qualifiers
FT   CDS             join(400190..400420,400492..401394)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977309"
FT                   /orf_name="Pc16g01700"
FT                   /product="Pc16g01700 protein"
FT                   /function="metal ion binding"
FT                   /function="porphobilinogen synthase activity"
FT                   /biological_process="tetrapyrrole biosynthetic process "
FT                   /protein_id="CAP92840.1"
FT                   /db_xref="GO:0004655"
FT                   /db_xref="GO:0033014"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00018315D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H727"
FT                   /transl_table=1
FT                   /translation="MSFSNLVSDIAFRDARVDDGSSQISHARSHRSHATARSYASTAAT
FT                   SVSISGEVSSQLHSGYSHPLTRAWQADRQLTKDMLIYPLFITDNPDEETSIPSLPNQYR
FT                   RGINRLVPFLAPLVRKGLRSVMLFGVPLQPSAKDALGTAADDPDGPVIQAIRLLRSRFP
FT                   QLYITTDVCLCEYTSHGHCGILREDGSLDNAQSVDRISDVAIAYAAAGAHCVAPSDMND
FT                   GRIRAIKLKLIEAGMAHRVLLMSYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGR
FT                   GLARRAIQRDMAEGADIIMVKPASSYLDIIRDAKDLAPDLPVAAYQVSGEFAMIHAAAK
FT                   AGVFNLKDMAFESTEGILRAGAGIVISYFVPEFLDWL"
     MSFSNLVSDI AFRDARVDDG SSQISHARSH RSHATARSYA STAATSVSIS GEVSSQLHSG        60
     YSHPLTRAWQ ADRQLTKDML IYPLFITDNP DEETSIPSLP NQYRRGINRL VPFLAPLVRK       120
     GLRSVMLFGV PLQPSAKDAL GTAADDPDGP VIQAIRLLRS RFPQLYITTD VCLCEYTSHG       180
     HCGILREDGS LDNAQSVDRI SDVAIAYAAA GAHCVAPSDM NDGRIRAIKL KLIEAGMAHR       240
     VLLMSYSAKF SGCLYGPFRD AAGSCPSFGD RRCYQLPPGG RGLARRAIQR DMAEGADIIM       300
     VKPASSYLDI IRDAKDLAPD LPVAAYQVSG EFAMIHAAAK AGVFNLKDMA FESTEGILRA       360
     GAGIVISYFV PEFLDWL                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page