(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE171

PENCW_13.PE171       Location/Qualifiers
FT   CDS             join(complement(403601..404396),complement(402172..403418))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209013" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824072"
FT                   /orf_name="Pc16g01710"
FT                   /product="Pc16g01710 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92841.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI00018315DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H728"
FT                   /transl_table=1
FT                   /translation="MTALAAGPVMNGGHDSGAETGTEHSPSRFTAVNGREPVNPGNTNG
FT                   KGNGPTPSSIPNGEHVPAQEKTNSDATQRDDRDDPANDQEKWSQRSSPSGSHNKNKRKR
FT                   SESRERDSVNASRSPVTRPMDSNQPNPNGSIPGSVSEMERGNHSATPSQRSEGNDAGQT
FT                   SANSPWSEYDSQLITQAQRAQQMDASDAHLADALQREAGQEKSITNRSTPGPQHPSSPG
FT                   YAPDRHGTMQVAPKRKRVFSNRTKTGCMTCRRRKKKCDEQHPACNNCIRGGFLCEGYSS
FT                   RSTWQKPSSTKTPIPLQSKEGYSDINGPYMQETSRPQDRQPGLVEHVDAAKIRPLVEEN
FT                   DRPVQQYSTSPTHTPSNHAWSKQAWPGAGPGATSNTGHPPYPSEPIAKVVDYREVPPIH
FT                   ELSREGRPKPDYPVISSLRDLSHPSHPKSSMPLFQNGPEQRTLPAAAVDTHSPQAQARM
FT                   ALSIEHQLSGRTVSSDETEKEKMIRGKLYRPFDVHLVEERDRCRGALWKFNNACNPLNG
FT                   ISSKEQNRLLKEVIVPPACSIVNSPAGTGVPRSVGSIGQGAVVEAPFSCHYGYNIHLGE
FT                   DVMISENCLFVDDCVIRIGAHTWIGPNVKIISSTAHPNMQERKGSQSRYQGRQVIIEED
FT                   CYVGAGCIIYPGVRLARGVYVAPGEIVNTNIAGYMFQGSKPSFAM"
     MTALAAGPVM NGGHDSGAET GTEHSPSRFT AVNGREPVNP GNTNGKGNGP TPSSIPNGEH        60
     VPAQEKTNSD ATQRDDRDDP ANDQEKWSQR SSPSGSHNKN KRKRSESRER DSVNASRSPV       120
     TRPMDSNQPN PNGSIPGSVS EMERGNHSAT PSQRSEGNDA GQTSANSPWS EYDSQLITQA       180
     QRAQQMDASD AHLADALQRE AGQEKSITNR STPGPQHPSS PGYAPDRHGT MQVAPKRKRV       240
     FSNRTKTGCM TCRRRKKKCD EQHPACNNCI RGGFLCEGYS SRSTWQKPSS TKTPIPLQSK       300
     EGYSDINGPY MQETSRPQDR QPGLVEHVDA AKIRPLVEEN DRPVQQYSTS PTHTPSNHAW       360
     SKQAWPGAGP GATSNTGHPP YPSEPIAKVV DYREVPPIHE LSREGRPKPD YPVISSLRDL       420
     SHPSHPKSSM PLFQNGPEQR TLPAAAVDTH SPQAQARMAL SIEHQLSGRT VSSDETEKEK       480
     MIRGKLYRPF DVHLVEERDR CRGALWKFNN ACNPLNGISS KEQNRLLKEV IVPPACSIVN       540
     SPAGTGVPRS VGSIGQGAVV EAPFSCHYGY NIHLGEDVMI SENCLFVDDC VIRIGAHTWI       600
     GPNVKIISST AHPNMQERKG SQSRYQGRQV IIEEDCYVGA GCIIYPGVRL ARGVYVAPGE       660
     IVNTNIAGYM FQGSKPSFAM                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page