(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE172

PENCW_13.PE172       Location/Qualifiers
FT   CDS             join(406307..406372,406495..406524,406589..406661,
FT                   406742..406813,406875..407587,407656..408898,
FT                   408967..409196,409302..409680,409739..409910,4
FT                   09968..410208)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209012" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946608"
FT                   /orf_name="Pc16g01720"
FT                   /product="Pc16g01720 protein"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAP92842.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018315DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H729"
FT                   /transl_table=1
FT                   /translation="MSISVQELDNTVRALFEGKGAVQNQAQQTLTEFKQNPDAWVTVGN
FT                   ILQEASYLQTKYIALQVLDNVIMTRWKVLPRDQCQGIRNFIVRFILENSESEEKIQAER
FT                   PLLNKLNLVLVSILKQEWPHNWPTFINEIISSCHASLSICENNMTILRLLSEEVFDFSQ
FT                   DQMTSAKARNLKTSMTSEFASIFQLCSEVLNTANQPSLVKATLETLLRFLNWIPLGYIF
FT                   ETPIINTLLTRFLGEPEFRNVTLKCLTEIGGLQIGAPYNYDERLVHMFTETLTTVSNVI
FT                   PLSLDLKQTYAMSNGRDQEFVSNLALFLSSFFSAHLDLIEKLPNQDYLTHAHFYLIRVS
FT                   QIDDREVFKICLDYWTRLVQELYEEMQQLPITDINPLVSMSVSGLANGGAPNPTTLANY
FT                   PLRKHKYETVLTNLRTVMIEKMVRPEEVLVVENDEGEIVREFVKESDTIQLYKTIRECL
FT                   VYLTHLDVVDTETIMIDKLAKQVDGTEWSWVNCNTLCWAIGSISGAMNEETEKRFLVTV
FT                   IKDLLGLTEQKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVNKLFEFMHETHEG
FT                   VQDMACDTFIKIANKCRRHFVALQPGESEPFIEEIVRNMRKITMDLSPQQIHTFYEACG
FT                   YMISAQGQKGLQDRLTENLMALPNTAWDQIIAEANQNPAILQDANTIKIVGNIMKTNVA
FT                   ACSSIGTYFYSQIGRIYHDMLNMYRAASQLINDAVASDGAIAPKTPKVRGLRTIKKEIL
FT                   KLIDTYVDKSDDLEMVNASMVPPLMEAVLIDYARNVPDAREAEVLNAMTTIIHKLHNLM
FT                   EDKIPAIMDSVFNCTLEMINKDFHEYPEHRVEFFKLLQAVNLYCFQALLKLDAAQFKFV
FT                   IDSCMWASKHDNREVENTGLTMCLELMNNMAETDPQTSSIFFREFYIPILQDVFFVLTD
FT                   SDHKAGFKSQAMLLSRMFYFVESGKIQEPIYSPDQAPAGTSNKDFLQEHIANLLKNAFG
FT                   NLQEAQIKQFVLGLFAYTDDLNKFKTHLRDFLISLKEFSDDNAELYAEEREQAVRDAQV
FT                   AERDRAMKVGGLLKPSEMDHEDEL"
     MSISVQELDN TVRALFEGKG AVQNQAQQTL TEFKQNPDAW VTVGNILQEA SYLQTKYIAL        60
     QVLDNVIMTR WKVLPRDQCQ GIRNFIVRFI LENSESEEKI QAERPLLNKL NLVLVSILKQ       120
     EWPHNWPTFI NEIISSCHAS LSICENNMTI LRLLSEEVFD FSQDQMTSAK ARNLKTSMTS       180
     EFASIFQLCS EVLNTANQPS LVKATLETLL RFLNWIPLGY IFETPIINTL LTRFLGEPEF       240
     RNVTLKCLTE IGGLQIGAPY NYDERLVHMF TETLTTVSNV IPLSLDLKQT YAMSNGRDQE       300
     FVSNLALFLS SFFSAHLDLI EKLPNQDYLT HAHFYLIRVS QIDDREVFKI CLDYWTRLVQ       360
     ELYEEMQQLP ITDINPLVSM SVSGLANGGA PNPTTLANYP LRKHKYETVL TNLRTVMIEK       420
     MVRPEEVLVV ENDEGEIVRE FVKESDTIQL YKTIRECLVY LTHLDVVDTE TIMIDKLAKQ       480
     VDGTEWSWVN CNTLCWAIGS ISGAMNEETE KRFLVTVIKD LLGLTEQKRG KDNKAVVASN       540
     IMYIVGQYPR FLKAHWKFLK TVVNKLFEFM HETHEGVQDM ACDTFIKIAN KCRRHFVALQ       600
     PGESEPFIEE IVRNMRKITM DLSPQQIHTF YEACGYMISA QGQKGLQDRL TENLMALPNT       660
     AWDQIIAEAN QNPAILQDAN TIKIVGNIMK TNVAACSSIG TYFYSQIGRI YHDMLNMYRA       720
     ASQLINDAVA SDGAIAPKTP KVRGLRTIKK EILKLIDTYV DKSDDLEMVN ASMVPPLMEA       780
     VLIDYARNVP DAREAEVLNA MTTIIHKLHN LMEDKIPAIM DSVFNCTLEM INKDFHEYPE       840
     HRVEFFKLLQ AVNLYCFQAL LKLDAAQFKF VIDSCMWASK HDNREVENTG LTMCLELMNN       900
     MAETDPQTSS IFFREFYIPI LQDVFFVLTD SDHKAGFKSQ AMLLSRMFYF VESGKIQEPI       960
     YSPDQAPAGT SNKDFLQEHI ANLLKNAFGN LQEAQIKQFV LGLFAYTDDL NKFKTHLRDF      1020
     LISLKEFSDD NAELYAEERE QAVRDAQVAE RDRAMKVGGL LKPSEMDHED EL              1072
//

If you have problems or comments...

PBIL Back to PBIL home page