(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE175

PENCW_13.PE175       Location/Qualifiers
FT   CDS             join(414451..414682,414740..414798,414908..414997)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824073"
FT                   /orf_name="Pc16g01750"
FT                   /product="Pc16g01750 protein"
FT                   /protein_id="CAP92845.1"
FT                   /db_xref="InterPro:IPR013963"
FT                   /db_xref="UniParc:UPI00018315DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H753"
FT                   /transl_table=1
FT                   /translation="MAYSSRPTSMLPGAPGGSSMRQPSGSQSQQSSALSARIAAKKAEL
FT                   ENLRQLRDLSGTLAIQMQALDNKISTLKDGTEAVAYVLSNWDNVLRAITLASKNVEKPR
FT                   NDARLPSTLVRIPAEPRDKTGE"
     MAYSSRPTSM LPGAPGGSSM RQPSGSQSQQ SSALSARIAA KKAELENLRQ LRDLSGTLAI        60
     QMQALDNKIS TLKDGTEAVA YVLSNWDNVL RAITLASKNV EKPRNDARLP STLVRIPAEP       120
     RDKTGE                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page