(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE176

PENCW_13.PE176       Location/Qualifiers
FT   CDS             416337..416711
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201309" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977310"
FT                   /orf_name="Pc16g01760"
FT                   /product="Putative uncharacterized protein Pc16g01760 "
FT                   /protein_id="CAP92846.1"
FT                   /db_xref="UniParc:UPI00018315DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H754"
FT                   /transl_table=1
FT                   /translation="MSTEWSLDFCLVCDRQTLGAPYCSQTCRLAELDEVSDGMSRRSSA
FT                   ASTHWSEINQAQARAEALKADTHNPSRTLSVSSSQTSLSSLKSNTSTSSNVADRLQDEL
FT                   RDYASCFDQVRDLKRRMTTT"
     MSTEWSLDFC LVCDRQTLGA PYCSQTCRLA ELDEVSDGMS RRSSAASTHW SEINQAQARA        60
     EALKADTHNP SRTLSVSSSQ TSLSSLKSNT STSSNVADRL QDELRDYASC FDQVRDLKRR       120
     MTTT                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page