(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE177

PENCW_13.PE177       Location/Qualifiers
FT   CDS             join(complement(418815..419183),complement(417960..418717),
FT                   complement(417774..417892),complement(417399..417706))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161565" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671368"
FT                   /orf_name="Pc16g01770"
FT                   /product="Pc16g01770 protein"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92847.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI00018316CB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H755"
FT                   /transl_table=1
FT                   /translation="MAIAAALASLQGSVIEYPYHSLAAAAVLAPILYVILNEFIRDAAR
FT                   VKGMKGPRGLPLIGNLAQIRKDAAEQYRLWSKKHGAVYQIQLGNIPVVVVNSAASAKVL
FT                   FGQNAQALSSRPETYTFHKIVSNTAGTTIGTSPYSDSLKRRRKGAASALNRPSVDTYVS
FT                   HLDVESKAFVEELYRYGNHGKTPVDPMAMIQRLSLSLALTLNWGVRIASQEEELFDEIT
FT                   EVEEEISRFRSTTGNLQDYIPLLRLNPFSSNSKKAAEMRRRRDKYLGALNSDLDDRMAK
FT                   GTHKPCIQANVIMDKEAKLNSEELTSISLTMLSGGLDTVTTLVAWSLGLLAQRPDIQDR
FT                   AAKAIQEMYGEDDPMCSPDDDQRCAYIAALVKECLRFFTVLRLALPRTSIKDITYKGIT
FT                   IPKGTVFFLNAWACNMDPDVWTDPDDFRPERWLEQPDAPLFTYGMGYRMCAGSLLANRE
FT                   LYLVFIRTLNSFRLEPHDKTDCHPLRGNSDPTSLVAIPQKYKVRFVPKNEKALSKVLAQ
FT                   "
     MAIAAALASL QGSVIEYPYH SLAAAAVLAP ILYVILNEFI RDAARVKGMK GPRGLPLIGN        60
     LAQIRKDAAE QYRLWSKKHG AVYQIQLGNI PVVVVNSAAS AKVLFGQNAQ ALSSRPETYT       120
     FHKIVSNTAG TTIGTSPYSD SLKRRRKGAA SALNRPSVDT YVSHLDVESK AFVEELYRYG       180
     NHGKTPVDPM AMIQRLSLSL ALTLNWGVRI ASQEEELFDE ITEVEEEISR FRSTTGNLQD       240
     YIPLLRLNPF SSNSKKAAEM RRRRDKYLGA LNSDLDDRMA KGTHKPCIQA NVIMDKEAKL       300
     NSEELTSISL TMLSGGLDTV TTLVAWSLGL LAQRPDIQDR AAKAIQEMYG EDDPMCSPDD       360
     DQRCAYIAAL VKECLRFFTV LRLALPRTSI KDITYKGITI PKGTVFFLNA WACNMDPDVW       420
     TDPDDFRPER WLEQPDAPLF TYGMGYRMCA GSLLANRELY LVFIRTLNSF RLEPHDKTDC       480
     HPLRGNSDPT SLVAIPQKYK VRFVPKNEKA LSKVLAQ                                517
//

If you have problems or comments...

PBIL Back to PBIL home page