(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE178

PENCW_13.PE178       Location/Qualifiers
FT   CDS             join(419310..419405,419836..419928,420018..420149,
FT                   420333..420410)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946611"
FT                   /orf_name="Pc16g01780"
FT                   /product="Putative uncharacterized protein Pc16g01780 "
FT                   /protein_id="CAP92848.1"
FT                   /db_xref="UniParc:UPI00018316CC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H756"
FT                   /transl_table=1
FT                   /translation="MEHFRVVKVVQPAMASLGVLLPHTTPGLARSQGLVKIISTCARTQ
FT                   DLLERRASFGKRFPKSGKFEGTRKQVDPKLFINGSPWSPVGPGWGKIAVPDWSIGQMEL
FT                   DSQKVESWKGEVGSSGRDNEISSRHVSE"
     MEHFRVVKVV QPAMASLGVL LPHTTPGLAR SQGLVKIIST CARTQDLLER RASFGKRFPK        60
     SGKFEGTRKQ VDPKLFINGS PWSPVGPGWG KIAVPDWSIG QMELDSQKVE SWKGEVGSSG       120
     RDNEISSRHV SE                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page