(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE179

PENCW_13.PE179       Location/Qualifiers
FT   CDS             join(420963..421393,421529..421788,421844..423172,
FT                   423235..423320)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946612"
FT                   /orf_name="Pc16g01790"
FT                   /product="Pc16g01790 protein"
FT                   /function="glycerol-3-phosphate dehydrogenase activity "
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="CAP92849.1"
FT                   /db_xref="GO:0004368"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI00018316CD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H757"
FT                   /transl_table=1
FT                   /translation="MAARHSRKLLRPLLYTSAAAAAGAGVLYISYRPRNIPGLEAPAVP
FT                   PPGYREGKLVPPSFPSIKSRLDQIQDLKRSNDEEEYDLLIIGAGATGAGIALDAATRGL
FT                   KVAVVERDDFSSGTSSKSTKLVHGGVRYLEKAVWELDYNQYALVKEALRERKYFLNTAP
FT                   HLSSWLPIMVPVQKWWQAPYFWAGTKAYDFLAGSEGIETSYFLTKSKAIDAFPMLKRDD
FT                   IIGAMVYYDGAHNDSRMNVSLAMTAALYGTTVVNHLEVTGLNKDASGKLCGARAKDLVT
FT                   EKNGEVAQEFNIRAKGVINATGPFSDSIRKMDEPDVKEIVAPSAGVHIILPGYFSPSNM
FT                   GLIDPSTSDGRVIFFLPWQGNTIAGTTDQPCEIEAQPQPTEKDINWILSEIRGYIAPDI
FT                   TVDRSDVLAAWSGIRPLVRDPKVKNSEALVRNHLVTVSQSGLLTCAGGKWTTYRQMAEE
FT                   AVDEAINVFKLKPRQLSTLPDISGVGGSGLVADGAVLDGSCQTHQVRLIGAHGFSKTLF
FT                   INLIQHFGLETDVAKHLTESYGDRSWQVAALSSPTSERFPVRGCRISPMYPFIDGEVRY
FT                   AVRHEYAQTAVDVIARRTRLAFLNAEAALESLPTVIDLMGEELEWSTARKDLEWKDSLT
FT                   FLSSMGLPKSFMGLSRRDVQNGRVKQVDDAERATFSRNEPPADMIESDKRATTAAPAAP
FT                   AATPSLN"
     MAARHSRKLL RPLLYTSAAA AAGAGVLYIS YRPRNIPGLE APAVPPPGYR EGKLVPPSFP        60
     SIKSRLDQIQ DLKRSNDEEE YDLLIIGAGA TGAGIALDAA TRGLKVAVVE RDDFSSGTSS       120
     KSTKLVHGGV RYLEKAVWEL DYNQYALVKE ALRERKYFLN TAPHLSSWLP IMVPVQKWWQ       180
     APYFWAGTKA YDFLAGSEGI ETSYFLTKSK AIDAFPMLKR DDIIGAMVYY DGAHNDSRMN       240
     VSLAMTAALY GTTVVNHLEV TGLNKDASGK LCGARAKDLV TEKNGEVAQE FNIRAKGVIN       300
     ATGPFSDSIR KMDEPDVKEI VAPSAGVHII LPGYFSPSNM GLIDPSTSDG RVIFFLPWQG       360
     NTIAGTTDQP CEIEAQPQPT EKDINWILSE IRGYIAPDIT VDRSDVLAAW SGIRPLVRDP       420
     KVKNSEALVR NHLVTVSQSG LLTCAGGKWT TYRQMAEEAV DEAINVFKLK PRQLSTLPDI       480
     SGVGGSGLVA DGAVLDGSCQ THQVRLIGAH GFSKTLFINL IQHFGLETDV AKHLTESYGD       540
     RSWQVAALSS PTSERFPVRG CRISPMYPFI DGEVRYAVRH EYAQTAVDVI ARRTRLAFLN       600
     AEAALESLPT VIDLMGEELE WSTARKDLEW KDSLTFLSSM GLPKSFMGLS RRDVQNGRVK       660
     QVDDAERATF SRNEPPADMI ESDKRATTAA PAAPAATPSL N                           701
//

If you have problems or comments...

PBIL Back to PBIL home page