(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE18

PENCW_13.PE18        Location/Qualifiers
FT   CDS             complement(42245..43294)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945512"
FT                   /orf_name="Pc16g00180"
FT                   /product="Pc16g00180 protein"
FT                   /protein_id="CAP92688.1"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI0001831DB0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6S9"
FT                   /transl_table=1
FT                   /translation="MHFHSTLLSGLAILPVALASWPFFEHTAKLSATPYRNERPNVKVE
FT                   TLFQFPNNGSWIDNMVIRSDGNLLLTRLDTPEVWLFDTTTGNATLAYSFPNVTSCFGIS
FT                   EIDDDVFAVVVGNFSAKTFQPGPASFSVQKLDFTKSDSEENARALGSPTASEIVAMPDA
FT                   GALNGMATLSRGSNLVLIADSPKGVIWKVDTKTGDYSVALNDTTMAPAKGQGLPLGVNA
FT                   LTVLGDYVYYTGTTQMVYCRVKVDKEANPVGDFEVIASGFLPDNVEMTEDGVAYIPTAP
FT                   QNSVVRLTPSGQISLVTGGQVSTQLAGPSSVRLSKDRQILYVGTNGGQIAPVLGSFIEP
FT                   AKIVKVSFE"
     MHFHSTLLSG LAILPVALAS WPFFEHTAKL SATPYRNERP NVKVETLFQF PNNGSWIDNM        60
     VIRSDGNLLL TRLDTPEVWL FDTTTGNATL AYSFPNVTSC FGISEIDDDV FAVVVGNFSA       120
     KTFQPGPASF SVQKLDFTKS DSEENARALG SPTASEIVAM PDAGALNGMA TLSRGSNLVL       180
     IADSPKGVIW KVDTKTGDYS VALNDTTMAP AKGQGLPLGV NALTVLGDYV YYTGTTQMVY       240
     CRVKVDKEAN PVGDFEVIAS GFLPDNVEMT EDGVAYIPTA PQNSVVRLTP SGQISLVTGG       300
     QVSTQLAGPS SVRLSKDRQI LYVGTNGGQI APVLGSFIEP AKIVKVSFE                   349
//

If you have problems or comments...

PBIL Back to PBIL home page