(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE180

PENCW_13.PE180       Location/Qualifiers
FT   CDS             join(423636..423799,423850..423863,423915..423987,
FT                   424041..424734,424791..424988,425052..425216)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946613"
FT                   /orf_name="Pc16g01800"
FT                   /product="Pc16g01800 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92850.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00018316CE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H758"
FT                   /transl_table=1
FT                   /translation="MNPNQCEIDSQPLSFVKQKLDPDKESVLPKPELEEQDPFGDESQA
FT                   GVKYKTMAWWQAGMIMIAETISLGILALPKALAVLGLIPGILTILGVGTISTYTAYTIG
FT                   QFKCRHVRVHSMADAGDILMGKIGRSTLDVAQLVFFVLVMGSHVLTFSIMMNVLTEHSS
FT                   CTIIFSVVGLLASFMLTLPRRLERLSHISSVSFVSIVGAVLTGMIGVTLVKEGPVHVSA
FT                   FSPSPKVHDACLAIANIIFAYAGHVAFFTLFSELRELRDFPKALALLQMSEMVLYTVAA
FT                   IVIYAYIGPTVNSPALNSAGQLFRKISYAIAIPTIVIGGVVNAHVAVKFIYVRVFRGTN
FT                   SMHSRSFLARLLWAAICAALWILSWIIAEGIPVFNDVLGLASSLFASWFSFGLPGLFWL
FT                   YLNRSCWFLTWRQRVLFGFNIFLVFLGFVIVSCVPL"
     MNPNQCEIDS QPLSFVKQKL DPDKESVLPK PELEEQDPFG DESQAGVKYK TMAWWQAGMI        60
     MIAETISLGI LALPKALAVL GLIPGILTIL GVGTISTYTA YTIGQFKCRH VRVHSMADAG       120
     DILMGKIGRS TLDVAQLVFF VLVMGSHVLT FSIMMNVLTE HSSCTIIFSV VGLLASFMLT       180
     LPRRLERLSH ISSVSFVSIV GAVLTGMIGV TLVKEGPVHV SAFSPSPKVH DACLAIANII       240
     FAYAGHVAFF TLFSELRELR DFPKALALLQ MSEMVLYTVA AIVIYAYIGP TVNSPALNSA       300
     GQLFRKISYA IAIPTIVIGG VVNAHVAVKF IYVRVFRGTN SMHSRSFLAR LLWAAICAAL       360
     WILSWIIAEG IPVFNDVLGL ASSLFASWFS FGLPGLFWLY LNRSCWFLTW RQRVLFGFNI       420
     FLVFLGFVIV SCVPL                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page