(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE181

PENCW_13.PE181       Location/Qualifiers
FT   CDS             complement(426741..427043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208979" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671369"
FT                   /orf_name="Pc16g01810"
FT                   /product="Pc16g01810 protein"
FT                   /protein_id="CAP92851.1"
FT                   /db_xref="UniParc:UPI00018316CF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H759"
FT                   /transl_table=1
FT                   /translation="MPNLPLSRSWPEIRQALEHARECEDGPVNAQSAAVLEAAITELWN
FT                   RIQAQPESYVLTPDEFALFNYFLATRYRGSTVAQRAVARFWNSYQKTTNCDGVSN"
     MPNLPLSRSW PEIRQALEHA RECEDGPVNA QSAAVLEAAI TELWNRIQAQ PESYVLTPDE        60
     FALFNYFLAT RYRGSTVAQR AVARFWNSYQ KTTNCDGVSN                             100
//

If you have problems or comments...

PBIL Back to PBIL home page