(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE182

PENCW_13.PE182       Location/Qualifiers
FT   CDS             join(429792..429864,429920..429963,430082..430208,
FT                   430270..430670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000041378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128406"
FT                   /orf_name="Pc16g01820"
FT                   /product="Pc16g01820 protein"
FT                   /protein_id="CAP92852.1"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniParc:UPI00018316D0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H760"
FT                   /transl_table=1
FT                   /translation="MVFYFTSTVVEPSAFIYVGKDKFENEDLIKYGLDNDVWYFHVDNL
FT                   SSAHVYVRLREGETWDNIAQPLLEDCAQLTKANSIEGNKKDNITIIYTPWSNLKKDGSM
FT                   AAGQVTFHNHKLVRKIYVKQRENPIVNRLNKTRVEKFPDLRAEKEEDMKKKQRSDRKAR
FT                   DEQRAKEKKKQQEYEQLKWQKNHAYDDMFTEENMEASNNQDRDEDFLDDFM"
     MVFYFTSTVV EPSAFIYVGK DKFENEDLIK YGLDNDVWYF HVDNLSSAHV YVRLREGETW        60
     DNIAQPLLED CAQLTKANSI EGNKKDNITI IYTPWSNLKK DGSMAAGQVT FHNHKLVRKI       120
     YVKQRENPIV NRLNKTRVEK FPDLRAEKEE DMKKKQRSDR KARDEQRAKE KKKQQEYEQL       180
     KWQKNHAYDD MFTEENMEAS NNQDRDEDFL DDFM                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page