(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE183

PENCW_13.PE183       Location/Qualifiers
FT   CDS             join(431282..431315,431363..431466,431522..431941,
FT                   431995..432710,432770..432876,432940..433181)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946614"
FT                   /orf_name="Pc16g01830"
FT                   /product="Pc16g01830 protein"
FT                   /protein_id="CAP92853.1"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR019459"
FT                   /db_xref="UniParc:UPI00018316D1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H761"
FT                   /transl_table=1
FT                   /translation="MSEGNPPSATPSAKSKKNKKKAAKAKADSKADEHAEDAPGDHDDT
FT                   DNEPHDANEDPIQVPESNGAKLNTIDGSLPDRSVNNQGPVATSDVPSGTDIHSDPASDG
FT                   TEPKDRFDALVRDRDSLRAEVADMRKSLEEIQSKHTADMEALQQKLDDAENKKEQAETQ
FT                   FQMLLERVNTIKSQLGERLKEDAEELALARSQIEDLEDENNNLKDELNSKSTQLIELSE
FT                   DSAEKEKELSTLRDRTNLSQQNWLKEKEELLEQESYLQSEFEQAKEAMHNWEILAMEER
FT                   SIRENLNEKVADLEEQLSSLRDGYERATHERDTQQSTVDGLQRALQEIQLARKQELREL
FT                   VESSDSQLENLRRSLREAQKQATDADKALQNAKEEIERVRPFEKEVKEKNLLIGKLRHE
FT                   AVTLNDHLTKALRFLKKGKPEDNVDRHIVTNHFLHFLALDRSDPKKFQILQLIAALLGW
FT                   NDEQREQAGLARPGTSSMPGKLRVPGTPLRTPSTPNLATEFMDNGASSKETLAELWSNF
FT                   LEQEAEVGNMSSSRRGSQQGPPK"
     MSEGNPPSAT PSAKSKKNKK KAAKAKADSK ADEHAEDAPG DHDDTDNEPH DANEDPIQVP        60
     ESNGAKLNTI DGSLPDRSVN NQGPVATSDV PSGTDIHSDP ASDGTEPKDR FDALVRDRDS       120
     LRAEVADMRK SLEEIQSKHT ADMEALQQKL DDAENKKEQA ETQFQMLLER VNTIKSQLGE       180
     RLKEDAEELA LARSQIEDLE DENNNLKDEL NSKSTQLIEL SEDSAEKEKE LSTLRDRTNL       240
     SQQNWLKEKE ELLEQESYLQ SEFEQAKEAM HNWEILAMEE RSIRENLNEK VADLEEQLSS       300
     LRDGYERATH ERDTQQSTVD GLQRALQEIQ LARKQELREL VESSDSQLEN LRRSLREAQK       360
     QATDADKALQ NAKEEIERVR PFEKEVKEKN LLIGKLRHEA VTLNDHLTKA LRFLKKGKPE       420
     DNVDRHIVTN HFLHFLALDR SDPKKFQILQ LIAALLGWND EQREQAGLAR PGTSSMPGKL       480
     RVPGTPLRTP STPNLATEFM DNGASSKETL AELWSNFLEQ EAEVGNMSSS RRGSQQGPPK       540
//

If you have problems or comments...

PBIL Back to PBIL home page